Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08690
Secondary Accession Numbers
  • 14411
Name Zinc transporter ZIP14
Synonyms
  1. LIV-1 subfamily of ZIP zinc transporter 4
  2. LZT-Hs4
  3. Solute carrier family 39 member 14
  4. ZIP-14
  5. Zrt- and Irt-like protein 14
Gene Name SLC39A14
Protein Type Unknown
Biological Properties
General Function Involved in metal ion transmembrane transporter activity
Specific Function May mediate cellular uptake of nontransferrin-bound iron (By similarity). Broad-scope metal ion transporter with a preference for zinc uptake.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
zinc ion transmembrane import
cellular zinc ion homeostasis
Cellular Component
endoplasmic reticulum
Golgi apparatus
lamellipodium
integral to plasma membrane
Component
membrane
cell part
Function
metal ion transmembrane transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
transporter activity
Molecular Function
zinc ion transmembrane transporter activity
ferrous iron transmembrane transporter activity
Process
establishment of localization
transport
transmembrane transport
ion transport
cation transport
metal ion transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein (Potential)
  3. Cell projection
  4. lamellipodium
Gene Properties
Chromosome Location 8
Locus 8p21.3
SNPs SLC39A14
Gene Sequence
>1479 bp
ATGAAGCTGCTGCTGCTGCACCCGGCCTTCCAGAGCTGCCTCCTGCTGACCCTGCTTGGC
TTATGGAGAACCACCCCTGAGGCTCACGCTTCATCCCTGGGTGCACCAGCTATCAGCGCT
GCCTCCTTCCTGCAGGATCTAATACATCGGTATGGCGAGGGTGACAGCCTCACTCTGCAG
CAGCTGAAGGCCCTACTCAACCACCTGGATGTGGGAGTGGGCCGGGGTAATGTCACCCAG
CACGTGCAAGGACACAGGAACCTCTCCACGTGCTTTAGTTCTGGAGACCTCTTCACTGCC
CACAATTTCAGCGAGCAGTCGCGGATTGGGAGCAGCGAGCTCCAGGAGTTCTGCCCCACC
ATCCTCCAGCAGCTGGATTCCCGGGCCTGCACCTCGGAGAACCAGGAAAACGAGGAGAAT
GAGCAGACGGAGGAGGGGCGGCCAAGCGCTGTTGAAGTGTGGGGATACGGTCTCCTCTGT
GTGACCGTCATCTCCCTCTGCTCCCTCCTGGGGGCCAGCGTGGTGCCCTTCATGAAGAAG
ACCTTTTACAAGAGGCTGCTGCTCTACTTCATAGCTCTGGCGATTGGAACCCTCTACTCC
AACGCCCTCTTCCAGCTCATCCCGGAGGCATTTGGTTTCAACCCTCTGGAAGATTATTAT
GTCTCCAAGTCTGCAGTGGTGTTTGGGGGCTTTTATCTTTTCTTTTTCACAGAGAAGATC
TTGAAGATTCTTCTTAAGCAGAAAAATGAGCATCATCATGGACACAGCCATTATGCCTCT
GAGTCGCTTCCCTCCAAGAAGGACCAGGAGGAGGGGGTGATGGAGAAGCTGCAGAACGGG
GACCTGGACCACATGATTCCTCAGCACTGCAGCAGTGAGCTGGACGGCAAGGCGCCCATG
GTGGACGAGAAGGTCATTGTGGGCTCGCTCTCTGTGCAGGACCTGCAGGCTTCCCAGAGT
GCTTGCTACTGGCTGAAAGGTGTCCGCTACTCTGATATCGGCACTCTGGCCTGGATGATC
ACTCTGAGCGACGGCCTCCATAATTTCATCGATGGCCTGGCCATCGGTGCTTCCTTCACT
GTGTCAGTTTTCCAAGGCATCAGCACCTCGGTGGCCATCCTCTGTGAGGAGTTCCCACAT
GAGCTAGGAGACTTTGTCATCCTGCTCAACGCTGGGATGAGCATCCAACAAGCTCTCTTC
TTCAACTTCCTTTCTGCCTGCTGCTGCTACCTGGGTCTGGCCTTTGGCATCCTGGCCGGC
AGCCACTTCTCTGCCAACTGGATTTTTGCGCTAGCTGGAGGAATGTTCTTGTATATTTCT
CTGGCTGATATGTTCCCTGAGATGAATGAGGTCTGTCAAGAGGATGAAAGGAAGGGCAGC
ATCTTGATTCCATTTATCATCCAGAACCTGGGCCTCCTGACTGGATTCACCATCATGGTG
GTCCTCACCATGTATTCAGGACAGATCCAGATTGGGTAG
Protein Properties
Number of Residues 492
Molecular Weight 54211.785
Theoretical pI 5.327
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Zinc transporter ZIP14
MKLLLLHPAFQSCLLLTLLGLWRTTPEAHASSPGAPAISAASFLQDLIHRYGEGDSLTLQ
QLKALLNHLDVGVGRGNVTQHVQGHRNLSTCFSSGDLFTAHNFSEQSRIGSSELQEFCPT
ILQQLDSRACTSENQENEENEQTEEGRPSAVEVWGYGLLCVTVISLCSLLGASVVPFMKK
TFYKRLLLYFIALAIGTLYSNALFQLIPEAFGFNPLEDYYVSKSAVVFGGFYLFFFTEKI
LKILLKQKNEHHHGHSHYASESLPSKKDQEEGVMEKLQNGDLDHMIPQHCSSELDGKAPM
VDEKVIVGSLSVQDLQASQSACYWLKGVRYSDIGTLAWMITLSDGLHNFIDGLAIGASFT
VSVFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGLAFGILAG
SHFSANWIFALAGGMFLYISLADMFPEMNEVCQEDERKGSILIPFIIQNLGLLTGFTIMV
VLTMYSGQIQIG
GenBank ID Protein 190360568
UniProtKB/Swiss-Prot ID Q15043
UniProtKB/Swiss-Prot Entry Name S39AE_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001128431.2
GeneCard ID SLC39A14
GenAtlas ID SLC39A14
HGNC ID HGNC:20858
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD: Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins. Nat Biotechnol. 2009 Apr;27(4):378-86. doi: 10.1038/nbt.1532. Epub 2009 Apr 6. [PubMed:19349973 ]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  5. Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Allen NR, Anderson S, Asakawa T, Blechschmidt K, Bloom T, Borowsky ML, Butler J, Cook A, Corum B, DeArellano K, DeCaprio D, Dooley KT, Dorris L 3rd, Engels R, Glockner G, Hafez N, Hagopian DS, Hall JL, Ishikawa SK, Jaffe DB, Kamat A, Kudoh J, Lehmann R, Lokitsang T, Macdonald P, Major JE, Matthews CD, Mauceli E, Menzel U, Mihalev AH, Minoshima S, Murayama Y, Naylor JW, Nicol R, Nguyen C, O'Leary SB, O'Neill K, Parker SC, Polley A, Raymond CK, Reichwald K, Rodriguez J, Sasaki T, Schilhabel M, Siddiqui R, Smith CL, Sneddon TP, Talamas JA, Tenzin P, Topham K, Venkataraman V, Wen G, Yamazaki S, Young SK, Zeng Q, Zimmer AR, Rosenthal A, Birren BW, Platzer M, Shimizu N, Lander ES: DNA sequence and analysis of human chromosome 8. Nature. 2006 Jan 19;439(7074):331-5. [PubMed:16421571 ]
  6. Nomura N, Nagase T, Miyajima N, Sazuka T, Tanaka A, Sato S, Seki N, Kawarabayasi Y, Ishikawa K, Tabata S: Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1. DNA Res. 1994;1(5):223-9. [PubMed:7584044 ]
  7. Taylor KM, Nicholson RI: The LZT proteins; the LIV-1 subfamily of zinc transporters. Biochim Biophys Acta. 2003 Apr 1;1611(1-2):16-30. [PubMed:12659941 ]
  8. Taylor KM, Morgan HE, Johnson A, Nicholson RI: Structure-function analysis of a novel member of the LIV-1 subfamily of zinc transporters, ZIP14. FEBS Lett. 2005 Jan 17;579(2):427-32. [PubMed:15642354 ]