Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08696
Secondary Accession Numbers
  • 14417
Name Beta-synuclein
Synonyms Not Available
Gene Name SNCB
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function Non-amyloid component of senile plaques found in Alzheimer disease. Could act as a regulator of SNCA aggregation process. Protects neurons from staurosporine and 6-hydroxy dopamine (6OHDA)-stimulated caspase activation in a TP53/p53- dependent manner. Contributes to restore the SNCA anti-apoptotic function abolished by 6OHDA. Not found in the Lewy bodies associated with Parkinson disease
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular part
cytoplasm
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:5
Locus 5q35
SNPs SNCB
Gene Sequence
>405 bp
ATGGACGTGTTCATGAAGGGCCTGTCCATGGCCAAGGAGGGCGTTGTGGCAGCCGCGGAG
AAAACCAAGCAGGGGGTCACCGAGGCGGCGGAGAAGACCAAGGAGGGCGTCCTTTACGTC
GGAAGCAAGACCCGAGAAGGTGTGGTACAAGGTGTGGCTTCAGTGGCTGAAAAAACCAAG
GAACAGGCCTCACATCTGGGAGGAGCTGTGTTCTCTGGGGCAGGGAACATCGCAGCAGCC
ACAGGACTGGTGAAGAGGGAGGAATTCCCTACTGATCTGAAGCCAGAGGAAGTGGCCCAG
GAAGCTGCTGAAGAACCACTGATTGAGCCCCTGATGGAGCCAGAAGGGGAGAGTTATGAG
GACCCACCCCAGGAGGAATATCAGGAGTATGAGCCAGAGGCGTAG
Protein Properties
Number of Residues 134
Molecular Weight 14287.8
Theoretical pI 4.09
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Beta-synuclein
MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTK
EQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYE
DPPQEEYQEYEPEA
GenBank ID Protein 3930222
UniProtKB/Swiss-Prot ID Q16143
UniProtKB/Swiss-Prot Entry Name SYUB_HUMAN
PDB IDs Not Available
GenBank Gene ID AF053136
GeneCard ID SNCB
GenAtlas ID SNCB
HGNC ID HGNC:11140
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Pronin AN, Morris AJ, Surguchov A, Benovic JL: Synucleins are a novel class of substrates for G protein-coupled receptor kinases. J Biol Chem. 2000 Aug 25;275(34):26515-22. [PubMed:10852916 ]
  3. Jakes R, Spillantini MG, Goedert M: Identification of two distinct synucleins from human brain. FEBS Lett. 1994 May 23;345(1):27-32. [PubMed:8194594 ]
  4. Lavedan C, Leroy E, Torres R, Dehejia A, Dutra A, Buchholtz S, Nussbaum RL, Polymeropoulos MH: Genomic organization and expression of the human beta-synuclein gene (SNCB). Genomics. 1998 Nov 15;54(1):173-5. [PubMed:9806846 ]