Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08698
Secondary Accession Numbers
  • 14419
Name Melanotransferrin
Synonyms
  1. CD228 antigen
  2. Melanoma-associated antigen p97
Gene Name MFI2
Protein Type Unknown
Biological Properties
General Function Involved in ferric iron binding
Specific Function Involved in iron cellular uptake. Seems to be internalized and then recycled back to the cell membrane. Binds a single atom of iron per subunit. Could also bind zinc
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
iron ion binding
ferric iron binding
Process
establishment of localization
transport
biological regulation
ion transport
cation transport
metal ion transport
transition metal ion transport
iron ion transport
regulation of biological quality
homeostatic process
chemical homeostasis
ion homeostasis
cellular ion homeostasis
cellular cation homeostasis
cellular di-, tri-valent inorganic cation homeostasis
cellular iron ion homeostasis
Cellular Location
  1. Lipid-anchor
  2. GPI- anchor
  3. Isoform 1:Cell membrane
Gene Properties
Chromosome Location Chromosome:3
Locus 3q28-q29
SNPs MFI2
Gene Sequence
>2217 bp
ATGCGGGGTCCGAGCGGGGCTCTGTGGCTGCTCCTGGCTCTGCGCACCGTGCTCGGTGGC
ATGGAGGTGCGGTGGTGCGCCACCTCGGACCCAGAGCAGCACAAGTGCGGCAACATGAGC
GAGGCCTTCCGGGAAGCGGGCATCCAGCCCTCCCTCCTCTGCGTCCGGGGCACCTCCGCC
GACCACTGCGTCCAGCTCATCGCGGCCCAGGAGGCTGACGCCATCACTCTGGATGGAGGA
GCCATCTATGAGGCGGGAAAGGAGCACGGCCTGAAGCCGGTGGTGGGCGAAGTGTACGAT
CAAGAGGTCGGTACCTCCTATTACGCCGTGGCTGTGGTCAGGAGGAGCTCCCATGTGACC
ATTGACACCCTGAAAGGCGTGAAGTCCTGCCACACGGGCATCAATCGCACAGTGGGCTGG
AACGTGCCCGTGGGCTACCTGGTGGAGAGCGGCCGCCTCTCGGTGATGGGCTGCGATGTA
CTCAAAGCTGTCAGCGACTATTTTGGGGGCAGCTGCGTCCCGGGGGCAGGAGAGACCAGT
TACTCTGAGTCCCTCTGTCGCCTCTGCAGGGGTGACAGCTCTGGGGAAGGGGTGTGTGAC
AAGAGCCCCCTGGAGAGATACTACGACTACAGCGGGGCCTTCCGGTGCCTGGCGGAAGGG
GCAGGGGACGTGGCTTTTGTGAAGCACAGCACGGTACTGGAGAACACGGATGGGAAGACG
CTTCCCTCCTGGGGCCAGGCCCTGCTGTCACAGGACTTCGAGCTGCTGTGCCGGGATGGT
AGCCGGGCCGATGTCACCGAGTGGAGGCAGTGCCATCTGGCCCGGGTGCCTGCTCACGCC
GTGGTGGTCCGGGCCGACACAGATGGGGGCCTCATCTTCCGGCTGCTCAACGAAGGCCAG
CGTCTGTTCAGCCACGAGGGCAGCAGCTTCCAGATGTTCAGCTCTGAGGCCTATGGCCAG
AAGGATCTACTCTTCAAAGACTCTACCTCGGAGCTTGTGCCCATCGCCACACAGACCTAT
GAGGCGTGGCTGGGCCATGAGTACCTGCACGCCATGAAGGGTCTGCTCTGTGACCCCAAC
CGGCTGCCCCCCTACCTGCGCTGGTGTGTGCTCTCCACTCCCGAGATCCAGAAGTGTGGA
GACATGGCCGTGGCCTTCCGCCGGCAGCGGCTCAAGCCAGAGATCCAGTGCGTGTCAGCC
AAGTCCCCCCAACACTGCATGGAGCGGATCCAGGCTGAGCAGGTCGACGCTGTGACCCTG
AGTGGCGAGGACATTTACACGGCGGGGAAGACGTACGGCCTGGTTCCCGCAGCCGGGGAG
CACTATGCCCCGGAAGACAGCAGCAACTCGTACTACGTGGTGGCCGTGGTGAGACGGGAC
AGCTCCCACGCCTTCACCTTGGATGAGCTTCGGGGCAAGCGCTCCTGCCACGCCGGTTTC
GGCAGCCCTGCAGGCTGGGATGTCCCCGTGGGTGCCCTTATTCAGAGAGGCTTCATCCGG
CCCAAGGACTGTGACGTCCTCACAGCAGTGAGCGAGTTCTTCAATGCCAGCTGCGTGCCC
GTGAACAACCCCAAGAACTACCCCTCCTCGCTGTGTGCACTGTGCGTGGGGGACGAGCAG
GGCCGCAACAAGTGTGTGGGCAACAGCCAGGAGCGGTATTACGGCTACCGCGGCGCCTTC
AGGTGCCTGGTGGAGAATGCGGGTGACGTTGCCTTCGTCAGGCACACAACCGTCTTTGAC
AACACAAACGGCCACAATTCCGAGCCCTGGGCTGCTGAGCTCAGGTCAGAGGACTATGAA
CTGCTGTGCCCCAACGGGGCCCGAGCCGAGGTGTCCCAGTTTGCAGCCTGCAACCTGGCA
CAGATACCACCCCACGCCGTGATGGTCCGGCCCGACACCAACATCTTCACCGTGTATGGA
CTGCTGGACAAGGCCCAGGACCTGTTTGGAGACGACCACAATAAGAACGGGTTCAAAATG
TTCGACTCCTCCAACTATCATGGCCAAGACCTGCTTTTCAAGGATGCCACCGTCCGGGCG
GTGCCTGTCGGAGAGAAAACCACCTACCGCGGCTGGCTGGGGCTGGACTACGTGGCGGCG
CTGGAAGGGATGTCGTCTCAGCAGTGCTCGGGCGCAGCGGCCCCGGCGCCCGGGGCGCCC
CTGCTCCCGCTGCTGCTGCCCGCCCTCGCCGCCCGCCTGCTCCCGCCCGCCCTCTGA
Protein Properties
Number of Residues 738
Molecular Weight 80240.9
Theoretical pI 5.9
Pfam Domain Function
Signals
  • 1-19
Transmembrane Regions
  • None
Protein Sequence
>Melanotransferrin
MRGPSGALWLLLALRTVLGGMEVRWCATSDPEQHKCGNMSEAFREAGIQPSLLCVRGTSA
DHCVQLIAAQEADAITLDGGAIYEAGKEHGLKPVVGEVYDQEVGTSYYAVAVVRRSSHVT
IDTLKGVKSCHTGINRTVGWNVPVGYLVESGRLSVMGCDVLKAVSDYFGGSCVPGAGETS
YSESLCRLCRGDSSGEGVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGKT
LPSWGQALLSQDFELLCRDGSRADVTEWRQCHLARVPAHAVVVRADTDGGLIFRLLNEGQ
RLFSHEGSSFQMFSSEAYGQKDLLFKDSTSELVPIATQTYEAWLGHEYLHAMKGLLCDPN
RLPPYLRWCVLSTPEIQKCGDMAVAFRRQRLKPEIQCVSAKSPQHCMERIQAEQVDAVTL
SGEDIYTAGKKYGLVPAAGEHYAPEDSSNSYYVVAVVRRDSSHAFTLDELRGKRSCHAGF
GSPAGWDVPVGALIQRGFIRPKDCDVLTAVSEFFNASCVPVNNPKNYPSSLCALCVGDEQ
GRNKCVGNSQERYYGYRGAFRCLVENAGDVAFVRHTTVFDNTNGHNSEPWAAELRSEDYE
LLCPNGARAEVSQFAACNLAQIPPHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFKM
FDSSNYHGQDLLFKDATVRAVPVGEKTTYRGWLGLDYVAALEGMSSQQCSGAAAPAPGAP
LLPLLLPALAARLLPPAL
GenBank ID Protein 134244281
UniProtKB/Swiss-Prot ID P08582
UniProtKB/Swiss-Prot Entry Name TRFM_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_005929.5
GeneCard ID MFI2
GenAtlas ID MFI2
HGNC ID HGNC:7037
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Rose TM, Plowman GD, Teplow DB, Dreyer WJ, Hellstrom KE, Brown JP: Primary structure of the human melanoma-associated antigen p97 (melanotransferrin) deduced from the mRNA sequence. Proc Natl Acad Sci U S A. 1986 Mar;83(5):1261-5. [PubMed:2419904 ]
  3. Furukawa KS, Furukawa K, Real FX, Old LJ, Lloyd KO: A unique antigenic epitope of human melanoma is carried on the common melanoma glycoprotein gp95/p97. J Exp Med. 1989 Feb 1;169(2):585-90. [PubMed:2463331 ]
  4. Food MR, Rothenberger S, Gabathuler R, Haidl ID, Reid G, Jefferies WA: Transport and expression in human melanomas of a transferrin-like glycosylphosphatidylinositol-anchored protein. J Biol Chem. 1994 Jan 28;269(4):3034-40. [PubMed:8300636 ]
  5. Kennard ML, Richardson DR, Gabathuler R, Ponka P, Jefferies WA: A novel iron uptake mechanism mediated by GPI-anchored human p97. EMBO J. 1995 Sep 1;14(17):4178-86. [PubMed:7556058 ]
  6. Baker EN, Baker HM, Smith CA, Stebbins MR, Kahn M, Hellstrom KE, Hellstrom I: Human melanotransferrin (p97) has only one functional iron-binding site. FEBS Lett. 1992 Feb 24;298(2-3):215-8. [PubMed:1544447 ]
  7. Garratt RC, Jhoti H: A molecular model for the tumour-associated antigen, p97, suggests a Zn-binding function. FEBS Lett. 1992 Jun 22;305(1):55-61. [PubMed:1633859 ]