You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08706
Secondary Accession Numbers
  • 14428
Name Cell division protein kinase 11A
Synonyms
  1. Cell division cycle 2-like protein kinase 2
  2. Galactosyltransferase-associated protein kinase p58/GTA
  3. PITSLRE serine/threonine-protein kinase CDC2L2
Gene Name CDK11A
Protein Type Unknown
Biological Properties
General Function Involved in protein kinase activity
Specific Function Appears to play multiple roles in cell cycle progression, cytokinesis and apoptosis. The p110 isoforms have been suggested to be involved in pre-mRNA splicing, potentially by phosphorylating the splicing protein SFRS7. The p58 isoform may act as a negative regulator of normal cell cycle progression
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 1p36.33
SNPs CDK11A
Gene Sequence
>2343 bp
ATGGGTGATGAAAAGGACTCTTGGAAAGTGAAAACTTTAGATGAAATTCTTCAGGAAAAG
AAACGAAGGAAGGAACAAGAGGAGAAAGCAGAGATAAAACGCTTAAAAAATTCTGATGAC
CGGGATTCCAAGCGGGATTCCCTTGAGGAGGGGGAGCTGAGAGATCACTGCATGGAGATC
ACAATAAGGAACTCCCCGTATAGAAGAGAAGACTCAATGGAAGACAGAGGAGAAGAAGAT
GATTCTTTGGCCATCAAACCACCCCAGCAAATGTCTCGGAAAGAAAAAGTTCATCACAGA
AAAGATGAAAAGAGAAAAGAAAAATGTAGGCATCATAGCCATTCAGCAGAAGGGGGGAAG
CATGCTAGAGTGAAAGAAAGAGAGCACGAACGTCGGAAACGACATCGAGAAGAACAGGAT
AAAGCTCGCCGGGAATGGGAAAGACAGAAGAGAAGGGAAATGGCAAGGGAGCATTCCAGG
AGAGAAAGGGACCGCTTGGAGCAGTTAGAAAGGAAGCGGGAGCGGGAGCGCAAGATGCGG
GAGCAGCAGAAGGAGCAGCGGGAGCAGAAGGAGCGCGAGCGGCGGGCGGAGGAGCGGCGC
AAGGAGCGGGAGGCCCGCAGGGAAGTGTCTGCACATCACCGAACGATGAGAGAGGACTAC
AGCGACAAAGTGAAAGCCAGCCACTGGAGTCGCAGCCCGCCTCGGCCGCCGCGGGAGCGG
TTCGAGTTGGGAGACGGCCGGAAGCCAGTAAAAGAAGAGAAAATGGAAGAAAGGGACCTG
CTGTCCGACTTACAGGACATCAGCGACAGCGAGAGGAAGACCAGCTCGGCCGAGTCCTCG
TCAGCGGAATCAGGCTCAGGTTCTGAGGAAGAAGAGGAGGAGGAGGAAGAGGAGGAGGAG
GAAGGGAGCACCAGTGAAGAATCAGAGGAGGAGGAGGAGGAAGAGGAAGAGGAGGAGGAG
GAGACCGGCAGCAACTCTGAGGAGGCATCAGAGCAGTCTGCCGAAGAAGTAAGTGAGGAA
GAAATGAGTGAAGATGAAGAACGAGAAAATGAAAACCACCTCTTGGTTGTTCCAGAGTCA
CGGTTCGACCGAGATTCCGGGGAGAGTGAAGAAGCAGAGGAAGAAGTGGGTGAGGGAACG
CCGCAGAGCAGCGCCCTGACAGAGGGCGACTATGTGCCCGACTCCCCTGCCCTGTTGCCC
ATCGAGCTCAAGCAGGAGCTGCCCAAGTACCTGCCGGCCCTGCAGGGCTGCCGGAGCGTC
GAGGAGTTCCAGTGCCTGAACAGGATCGAGGAGGGCACCTATGGAGTGGTCTACAGAGCA
AAAGACAAGAAAACAGATGAAATTGTGGCTCTAAAGCGGCTGAAGATGGAGAAGGAGAAG
GAGGGCTTCCCGATCACGTCCCTGAGGGAGATCAACACCATCCTCAAGGCCCAGCATCCC
AACATTGTCACCGTTAGAGAGATTGTGGTGGGCAGCAACATGGACAAGATCTACATCGTG
ATGAACTACGTGGAGCACGACCTCAAGAGCCTGATGGAGACCATGAAACAGCCCTTCCTG
CCAGGGGAGGTGAAGACCCTGATGATCCAGCTGCTGCGGGGGGTGAAACACCTGCACGAC
AACTGGATCCTGCACCGTGACCTCAAGACGTCCAACCTGCTGCTGAGCCACGCCGGCATC
CTCAAGGTGGGTGATTTTGGGCTGGCGCGGGAGTACGGATCCCCTCTGAAGGCCTACACC
CCGGTCGTGGTGACCCAGTGGTACCGCGCCCCAGAGCTGCTGCTTGGTGCCAAGGAATAC
TCCACGGCCGTGGACATGTGGTCAGTGGGCTGCATCTTCGGGGAGCTGCTGACTCAGAAG
CCTCTGTTCCCCGGGAATTCGGAAATCGATCAGATCAACAAAGTGTTCAAGGAGCTGGGG
ACCCCCAGTGAGAAAATCTGGCCCGGCTACAGTGAGCTCCCAGTAGTCAAAAAGATGACC
TTCAGCGAGCACCCCTACAACAACCTCCGCAAGCGCTTCGGGGCTCTGCTCTCAGACCAG
GGCTTCGACCTCATGAACAAGTTCCTGACCTACTTCCCCGGGAGGAGGATCAGCGCTGAG
GACGGCCTCAAGCATGAGTATTTCCGCGAGACCCCCCTCCCCATCGACCCCTCCATGTTC
CCCACGTGGCCCGCCAAGAGCGAGCAGCAGCGTGTGAAGCGGGGCACCAGCCCGAGGCCC
CCTGAGGGAGGCCTGGGCTACAGCCAGCTGGGTGACGACGACCTGAAGGAGACGGGCTTC
CACCTTACCACCACGAACCAGGGGGCCTCTGCCGCGGGCCCCGGCTTCAGCCTCAAGTTC
TGA
Protein Properties
Number of Residues 780
Molecular Weight 90973.5
Theoretical pI 5.12
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cell division protein kinase 11A
MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHCMEI
TIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKVHHRKDEKRKEKWKHARVKEREHE
RRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQK
ERERRAEERRKEREARREVSAHHRTMREDYSDKVKASHWSRSPPRPPRERFELGDGRKPG
EARPAPAQKPAQLKEEKMEERDLLSDLQDISDSERKTSSAESSSAESGSGSEEEEEEEEE
EEEEGSTSEESEEEEEEEEEETGSNSEEASEQSAEEVSEEEMSEDEERENENHLLVVPES
RFDRDSGESEEAEEEVGEGTPQSSALTEGDYVPDSPALLPIELKQELPKYLPALQGCRSV
EEFQCLNRIEEGTYGVVYRAKDKKTDEIVALKRLKMEKEKEGFPITSLREINTILKAQHP
NIVTVREIVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPGEVKTLMIQLLRGVKHLHD
NWILHRDLKTSNLLLSHAGILKVGDFGLAREYGSPLKAYTPVVVTQWYRAPELLLGAKEY
STAVDMWSVGCIFGELLTQKPLFPGNSEIDQINKVFKELGTPSEKIWPGYSELPVVKKMT
FSEHPYNNLRKRFGALLSDQGFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMF
PTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF
GenBank ID Protein 148763347
UniProtKB/Swiss-Prot ID Q9UQ88
UniProtKB/Swiss-Prot Entry Name CD11A_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_024011.2
GeneCard ID CDK11A
GenAtlas ID CDK11A
HGNC ID HGNC:1730
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  8. Xiang J, Lahti JM, Grenet J, Easton J, Kidd VJ: Molecular cloning and expression of alternatively spliced PITSLRE protein kinase isoforms. J Biol Chem. 1994 Jun 3;269(22):15786-94. [PubMed:8195233 ]
  9. Gururajan R, Lahti JM, Grenet J, Easton J, Gruber I, Ambros PF, Kidd VJ: Duplication of a genomic region containing the Cdc2L1-2 and MMP21-22 genes on human chromosome 1p36.3 and their linkage to D1Z2. Genome Res. 1998 Sep;8(9):929-39. [PubMed:9750192 ]
  10. Cornelis S, Bruynooghe Y, Denecker G, Van Huffel S, Tinton S, Beyaert R: Identification and characterization of a novel cell cycle-regulated internal ribosome entry site. Mol Cell. 2000 Apr;5(4):597-605. [PubMed:10882096 ]
  11. Hu D, Mayeda A, Trembley JH, Lahti JM, Kidd VJ: CDK11 complexes promote pre-mRNA splicing. J Biol Chem. 2003 Mar 7;278(10):8623-9. Epub 2002 Dec 24. [PubMed:12501247 ]
  12. Chen S, Yin X, Zhu X, Yan J, Ji S, Chen C, Cai M, Zhang S, Zong H, Hu Y, Yuan Z, Shen Z, Gu J: The C-terminal kinase domain of the p34cdc2-related PITSLRE protein kinase (p110C) associates with p21-activated kinase 1 and inhibits its activity during anoikis. J Biol Chem. 2003 May 30;278(22):20029-36. Epub 2003 Mar 6. [PubMed:12624090 ]