You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08708
Secondary Accession Numbers
  • 14430
Name CCR4-NOT transcription complex subunit 6
Synonyms
  1. CCR4 carbon catabolite repression 4-like
  2. Carbon catabolite repressor protein 4 homolog
  3. Cytoplasmic deadenylase
Gene Name CNOT6
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Poly(A) nuclease involved in mRNA decay mediated by the major-protein-coding determinant of instability (mCRD) of the FOS gene in the cytoplasm. Has 3'-5' RNase activity. The CCR4-NOT complex functions as general transcription regulation complex
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
Cellular Location
  1. Cytoplasm (Probable)
  2. Nucleus (Probable)
Gene Properties
Chromosome Location Chromosome:5
Locus 5q35.3
SNPs CNOT6
Gene Sequence
>1674 bp
ATGCCCAAAGAAAAATACGAGCCCCCTGACCCTCGGAGGATGTATACAATTATGTCTTCT
GAGGAAGCAGCAAATGGAAAGAAATCCCACTGGGCAGAGCTTGAAATAAGTGGAAAAGTA
AGAAGCTTAAGCGCATCTTTGTGGTCACTAACTCACCTGACAGCTTTGCATTTGAGTGAC
AATTCCCTGTCCCGAATTCCTTCAGACATTGCCAAGCTTCACAATCTGGTGTATTTGGAC
CTGTCATCTAATAAAATTCGTAGCTTACCCGCAGAACTCGGAAACATGGTATCACTCAGG
GAGCTCCATTTAAATAACAACCTGTTACGAGTTCTACCTTTTGAGCTGGGAAAACTGTTT
CAGTTGCAGACTTTAGGCCTGAAAGGAAATCCCCTTACCCAGGATATATTGAACCTTTAT
CAGGAACCAGATGGAACAAGACGGCTGCTGAACTATTTGCTTGATAATTTGTCAGGTACT
GCAAAAAGAATTACAACAGAACAACCACCTCCAAGGTCTTGGATTATGTTACAAGAACCA
GATAGGACAAGGCCAACTGCCTTGTTTTCTGTCATGTGCTATAATGTTCTTTGTGATAAA
TATGCGACCCGGCAGTTATACGGCTACTGTCCATCATGGGCGCTAAACTGGGACTACAGG
AAAAAGGCCATTATTCAAGAAATCTTGAGCTGCAATGCTGATATCGTAAGTCTTCAGGAG
GTTGAAACGGAACAGTATTACAGTTTTTTTCTGGTAGAGCTGAAAGAACGTGGCTATAAT
GGATTCTTCAGTCCTAAGTCTAGAGCTAGGACAATGTCAGAACAAGAAAGGAAACATGTT
GATGGCTGTGCAATATTCTTCAAGACAGAAAAATTTACTTTGGTTCAGAAACACACTGTT
GAATTTAATCAGCTAGCCATGGCAAATTCTGAGGGGTCTGAAGCTATGCTGAACAGAGTC
ATGACAAAAGATAACATTGGGGTTGCAGTACTGCTAGAACTTCGGAAGGAATCGATTGAA
ATGCCGTCTGGAAAGCCACATCTTGGAACAGAAAAACAACTTATTCTTGTGGCTAACGCC
CACATGCATTGGGACCCTGAATACTCTGATGTGAAGTTGGTACAAACTATGATGTTCCTC
TCAGAAGTGAAGAACATTATTGATAAAGCCTCTCGCAACCTCAAATCCAGTGTTTTGGGA
GAATTTGGAACTATTCCACTTGTGTTATGTGCAGATCTTAATTCTTTGCCAGACTCTGGT
GTTGTAGAATATTTGAGCACAGGTGGAGTAGAAACAAATCACAAAGACTTTAAGGAGTTG
AGGTATAATGAAAGTCTCACAAACTTCAGCTGTCATGGGAAGAATGGAACCACCAATGGA
AGGATCACTCATGGTTTCAAGTTACAGAGTGCCTATGAGAGTGGCCTGATGCCTTACACG
AATTACACATTTGATTTCAAGGGTATAATAGACTACATTTTCTATTCTAAACCTCAGCTG
AACACCTTAGGCATCCTGGGCCCTCTGGACCACCACTGGCTGGTTGAGAATAACATCAGT
GGCTGCCCGCACCCCCTCATCCCCTCTGACCACTTCTCACTTTTTGCACAACTGGAGCTC
TTACTGCCTTTCCTGCCCCAAGTCAACGGCATCCACCTTCCTGGCAGGAGGTAG
Protein Properties
Number of Residues 557
Molecular Weight 63306.0
Theoretical pI 7.29
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>CCR4-NOT transcription complex subunit 6
MPKEKYEPPDPRRMYTIMSSEEAANGKKSHWAELEISGKVRSLSASLWSLTHLTALHLSD
NSLSRIPSDIAKLHNLVYLDLSSNKIRSLPAELGNMVSLRELHLNNNLLRVLPFELGKLF
QLQTLGLKGNPLTQDILNLYQEPDGTRRLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEP
DRTRPTALFSVMCYNVLCDKYATRQLYGYCPSWALNWDYRKKAIIQEILSCNADIVSLQE
VETEQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTV
EFNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKESIEMPSGKPHLGTEKQLILVANA
HMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRNLKSSVLGEFGTIPLVLCADLNSLPDSG
VVEYLSTGGVETNHKDFKELRYNESLTNFSCHGKNGTTNGRITHGFKLQSAYESGLMPYT
NYTFDFKGIIDYIFYSKPQLNTLGILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLEL
LLPFLPQVNGIHLPGRR
GenBank ID Protein 28872863
UniProtKB/Swiss-Prot ID Q9ULM6
UniProtKB/Swiss-Prot Entry Name CNOT6_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_015455.3
GeneCard ID CNOT6
GenAtlas ID CNOT6
HGNC ID HGNC:14099
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Nagase T, Ishikawa K, Kikuno R, Hirosawa M, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Oct 29;6(5):337-45. [PubMed:10574462 ]
  3. Dupressoir A, Morel AP, Barbot W, Loireau MP, Corbo L, Heidmann T: Identification of four families of yCCR4- and Mg2+-dependent endonuclease-related proteins in higher eukaryotes, and characterization of orthologs of yCCR4 with a conserved leucine-rich repeat essential for hCAF1/hPOP2 binding. BMC Genomics. 2001;2:9. Epub 2001 Nov 22. [PubMed:11747467 ]
  4. Chen J, Chiang YC, Denis CL: CCR4, a 3'-5' poly(A) RNA and ssDNA exonuclease, is the catalytic component of the cytoplasmic deadenylase. EMBO J. 2002 Mar 15;21(6):1414-26. [PubMed:11889047 ]
  5. Chang TC, Yamashita A, Chen CY, Yamashita Y, Zhu W, Durdan S, Kahvejian A, Sonenberg N, Shyu AB: UNR, a new partner of poly(A)-binding protein, plays a key role in translationally coupled mRNA turnover mediated by the c-fos major coding-region determinant. Genes Dev. 2004 Aug 15;18(16):2010-23. [PubMed:15314026 ]