You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08723
Secondary Accession Numbers
  • 14446
Name Eyes absent homolog 4
Synonyms Not Available
Gene Name EYA4
Protein Type Unknown
Biological Properties
General Function Involved in catalytic activity
Specific Function Tyrosine phosphatase that specifically dephosphorylates 'Tyr-142' of histone H2AX (H2AXY142ph). 'Tyr-142' phosphorylation of histone H2AX plays a central role in DNA repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress. Promotes efficient DNA repair by dephosphorylating H2AX, promoting the recruitment of DNA repair complexes containing MDC1. Its function as histone phosphatase probably explains its role in transcription regulation during organogenesis. May be involved in development of the eye (By similarity).
Pathways Not Available
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphate details
GO Classification
Biological Process
sensory perception of sound
DNA repair
anatomical structure morphogenesis
chromatin modification
middle ear morphogenesis
visual perception
regulation of transcription, DNA-dependent
transcription, DNA-dependent
peptidyl-tyrosine dephosphorylation
Cellular Component
cytoplasm
nucleus
Function
catalytic activity
Molecular Function
metal ion binding
protein tyrosine phosphatase activity
Process
metabolic process
multicellular organismal process
multicellular organismal development
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location 6
Locus 6q23
SNPs EYA4
Gene Sequence
>1920 bp
ATGGAAGACTCCCAGGATTTAAATGAACAATCAGTAAAGAAAACGTGCACAGAATCAGAT
GTTTCACAATCTCAGAATTCCAGGTCTATGGAAATGCAGGACCTAGCAAGTCCTCATACT
CTTGTTGGAGGTGGTGATACTCCAGGTAGCTCCAAACTGGAAAAATCTAATCTCAGCAGC
ACATCAGTTACTACAAATGGGACAGGAGGGGAAAACATGACTGTTTTAAACACAGCAGAC
TGGTTGCTGAGTTGCAACACCCCCTCTTCTGCAACAATGTCTCTTCTTGCAGTCAAAACA
GAGCCCTTGAACAGCAGTGAAACCACAGCCACGACTGGAGATGGAGCGCTTGACACTTTT
ACTGGGTCAGTAATTACAAGTAGTGGCTACAGCCCCAGATCAGCACATCAGTATTCCCCA
CAGCTGTATCCTTCCAAGCCCTATCCACACATTCTTTCTACACCAGCAGCTCAAACAATG
TCTGCCTATGCAGGCCAGACTCAGTATTCGGGGATGCAGCAGCCAGCCGTCTACACAGCC
TACTCACAGACAGGACAGCCCTACAGCTTGCCCACTTACGATTTGGGTGTGATGTTGCCA
GCCATCAAGACAGAGAGTGGACTTTCCCAAACTCAGTCCCCATTACAGAGTGGCTGCCTC
AGTTACAGCCCAGGGTTCTCTACCCCACAGCCAGGCCAGACACCTTATTCTTACCAAATG
CCAGGTTCTAGTTTTGCACCATCATCTACTATTTATGCAAATAATTCAGTTTCCAATTCA
ACGAATTTCAGTGGTTCACAACAGGATTATCCATCCTATACAGCCTTTGGCCAAAACCAG
TATGCACAGTATTATTCAGCATCAACGTATGGAGCGTATATGACATCGAATAACACAGCC
GATGGCACACCCTCTTCAACCTCTACTTATCAGTTGCAGGAATCTCTCCCAGGACTGACT
AACCAACCAGGAGAGTTCGATACCATGCAGAGTCCCTCCACACCCATCAAAGATCTTGAT
GAGAGAACCTGTAGGAGTTCTGGGTCAAAGTCCAGAGGAAGAGGCCGGAAAAATAATCCC
TCCCCGCCTCCTGATAGTGACCTGGAGCGTGTGTTTGTCTGGGATTTGGATGAAACCATC
ATTGTTTTTCACTCACTGCTCACCGGGTCTTATGCACAGAAGTATGGCAAGGATCCCCCC
ATGGCTGTAACCCTTGGACTCCGCATGGAAGAAATGATTTTTAATCTTGCTGATACTCAT
TTGTTTTTTAATGATTTAGAGGAGTGTGATCAAGTTCATATAGATGATGTTTCCTCTGAT
GATAATGGGCAGGACTTAAGTACCTACAGTTTTGCAACTGATGGCTTCCATGCAGCTGCA
AGTAGTGCAAACCTTTGTTTGCCAACAGGTGTAAGAGGAGGGGTTGACTGGATGAGGAAG
TTGGCTTTTCGTTACAGAAGAGTAAAAGAATTATATAACACCTACAAGAACAACGTTGGA
GGACTCCTTGGCCCTGCCAAGAGGGATGCCTGGCTACAGTTAAGGGCAGAGATTGAAGGT
CTGACAGATTCCTGGCTAACAAATGCACTTAAGTCTTTATCAATTATTAGCACTAGGAGT
AACTGCATAAATGTCTTGGTAACGACAACTCAACTGATCCCAGCACTTGCGAAGGTTCTA
CTCTATAGTTTAGGAGGTGCTTTCCCCATTGAGAATATTTACAGTGCAACTAAAATAGGA
AAAGAAAGTTGCTTTGAACGAATAATGCAAAGGTTTGGCAGAAAAGTAGTGTATGTTGTA
ATTGGGGATGGTGTAGAAGAAGAACAGGCAGCAAAAAAGCACAACATGCCCTTCTGGAGG
ATATCCAGTCACTCAGACCTCCTGGCTCTCCACCAAGCACTGGAATTAGAGTATTTGTAA
Protein Properties
Number of Residues 639
Molecular Weight 69504.46
Theoretical pI 5.2
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Eyes absent homolog 4
MEDSQDLNEQSVKKTCTESDVSQSQNSRSMEMQDLASPHTLVGGGDTPGSSKLEKSNLSS
TSVTTNGTGGENMTVLNTADWLLSCNTPSSATMSLLAVKTEPLNSSETTATTGDGALDTF
TGSVITSSGYSPRSAHQYSPQLYPSKPYPHILSTPAAQTMSAYAGQTQYSGMQQPAVYTA
YSQTGQPYSLPTYDLGVMLPAIKTESGLSQTQSPLQSGCLSYSPGFSTPQPGQTPYSYQM
PGSSFAPSSTIYANNSVSNSTNFSGSQQDYPSYTAFGQNQYAQYYSASTYGAYMTSNNTA
DGTPSSTSTYQLQESLPGLTNQPGEFDTMQSPSTPIKDLDERTCRSSGSKSRGRGRKNNP
SPPPDSDLERVFVWDLDETIIVFHSLLTGSYAQKYGKDPPMAVTLGLRMEEMIFNLADTH
LFFNDLEECDQVHIDDVSSDDNGQDLSTYSFATDGFHAAASSANLCLPTGVRGGVDWMRK
LAFRYRRVKELYNTYKNNVGGLLGPAKRDAWLQLRAEIEGLTDSWLTNALKSLSIISTRS
NCINVLVTTTQLIPALAKVLLYSLGGAFPIENIYSATKIGKESCFERIMQRFGRKVVYVV
IGDGVEEEQAAKKHNMPFWRISSHSDLLALHQALELEYL
GenBank ID Protein 98991760
UniProtKB/Swiss-Prot ID O95677
UniProtKB/Swiss-Prot Entry Name EYA4_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_004100.4
GeneCard ID EYA4
GenAtlas ID EYA4
HGNC ID HGNC:3522
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  7. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  8. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  9. Borsani G, DeGrandi A, Ballabio A, Bulfone A, Bernard L, Banfi S, Gattuso C, Mariani M, Dixon M, Donnai D, Metcalfe K, Winter R, Robertson M, Axton R, Brown A, van Heyningen V, Hanson I: EYA4, a novel vertebrate gene related to Drosophila eyes absent. Hum Mol Genet. 1999 Jan;8(1):11-23. [PubMed:9887327 ]
  10. Wayne S, Robertson NG, DeClau F, Chen N, Verhoeven K, Prasad S, Tranebjarg L, Morton CC, Ryan AF, Van Camp G, Smith RJ: Mutations in the transcriptional activator EYA4 cause late-onset deafness at the DFNA10 locus. Hum Mol Genet. 2001 Feb 1;10(3):195-200. [PubMed:11159937 ]
  11. Schonberger J, Wang L, Shin JT, Kim SD, Depreux FF, Zhu H, Zon L, Pizard A, Kim JB, Macrae CA, Mungall AJ, Seidman JG, Seidman CE: Mutation in the transcriptional coactivator EYA4 causes dilated cardiomyopathy and sensorineural hearing loss. Nat Genet. 2005 Apr;37(4):418-22. Epub 2005 Feb 27. [PubMed:15735644 ]