Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08728
Secondary Accession Numbers
  • 14451
Name Flap endonuclease GEN homolog 1
Synonyms Not Available
Gene Name GEN1
Protein Type Unknown
Biological Properties
General Function Involved in DNA binding
Specific Function Endonuclease which cleaves flap structures at the junction between single-stranded DNA and double-stranded DNA. Specific for 5'-overhanging flap structures in which the 5'- upstream of the flap is completely double-stranded. Prefers the blocked-flap structures similar to those occurring at replication forks, in which the 5' single-strand overhang of the flap is double-stranded
Pathways Not Available
Reactions Not Available
GO Classification
Function
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
nucleic acid binding
dna binding
nuclease activity
Process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
dna metabolic process
dna repair
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:2
Locus 2p24.2
SNPs GEN1
Gene Sequence
>2727 bp
ATGGGAGTGAATGACTTGTGGCAAATTTTGGAGCCTGTTAAGCAACACATCCCCTTGCGT
AATCTTGGTGGGAAAACCATTGCAGTTGATCTGAGTCTCTGGGTGTGTGAGGCACAGACA
GTCAAAAAAATGATGGGCAGCGTCATGAAGCCCCACCTCAGGAACTTATTTTTTCGTATC
TCATATTTAACACAAATGGATGTAAAACTGGTATTTGTTATGGAAGGGGAACCACCAAAG
CTGAAAGCTGATGTCATAAGCAAGAGGAATCAGTCTCGGTATGGGTCTTCTGGAAAATCG
TGGTCTCAGAAAACAGGGAGATCACATTTTAAATCAGTCTTAAGAGAGTGCCTCCATATG
CTCGAATGCTTAGGAATCCCCTGGGTTCAGGCTGCTGGGGAAGCTGAAGCCATGTGTGCT
TATCTCAATGCTGGTGGTCATGTCGATGGCTGCCTCACCAATGATGGAGATACTTTCCTT
TATGGGGCCCAGACTGTTTACAGGAATTTCACTATGAATACAAAGGACCCACATGTTGAC
TGTTACACAATGTCATCTATCAAGAGTAAACTAGGTTTGGATAGAGATGCTCTGGTTGGA
TTAGCAATACTTCTTGGCTGTGATTATCTCCCAAAGGGAGTCCCTGGAGTTGGAAAAGAG
CAAGCATTAAAACTTATACAGATTTTGAAAGGGCAAAGTTTACTTCAGAGGTTTAATCGG
TGGAATGAAACATCTTGTAACTCTAGTCCACAACTGCTAGTCACTAAAAAACTGGCTCAT
TGTTCCGTATGTTCCCATCCAGGTTCACCTAAGGATCATGAACGTAATGGATGCAGATTA
TGTAAAAGTGATAAATATTGTGAGCCACATGACTATGAATACTGCTGTCCTTGTGAGTGG
CACCGTACAGAACATGATAGGCAACTCAGTGAAGTAGAGAACAATATTAAGAAGAAAGCT
TGCTGTTGTGAGGGATTCCCATTCCATGAGGTTATTCAAGAATTCCTTTTAAACAAGGAT
AAATTGGTGAAGGTTATCAGGTACCAAAGACCTGATTTGTTATTGTTTCAGAGATTTACT
CTTGAAAAAATGGAGTGGCCCAATCACTATGCATGTGAGAAATTGCTGGTACTTTTGACC
CATTATGACATGATAGAAAGAAAGCTTGGTAGCAGAAACTCTAATCAACTACAGCCAATT
CGAATTGTTAAGACTCGAATCAGAAATGGAGTTCATTGTTTTGAAATAGAATGGGAAAAG
CCTGAACATTATGCTATGGAAGATAAACAACATGGAGAATTTGCTTTATTAACAATTGAG
GAAGAATCATTGTTTGAAGCAGCATATCCTGAGATCGTTGCTGTTTACCAAAAACAAAAG
TTAGAAATTAAAGGGAAGAAACAAAAACGTATTAAGCCTAAAGAAAACAATTTGCCAGAA
CCAGATGAAGTAATGAGCTTTCAGTCACACATGACTTTAAAACCCACATGTGAAATCTTT
CATAAGCAGAATTCCAAGTTAAATTCGGGGATTTCCCCTGATCCTACATTACCACAGGAA
TCTATTTCTGCCTCATTGAATAGCTTGCTTTTACCTAAAAATACTCCATGTTTGAATGCA
CAAGAACAGTTCATGTCTTCTCTAAGACCTTTGGCTATACAGCAAATTAAAGCTGTCAGT
AAGTCTCTAATTTCAGAATCTAGTCAACCCAATACCTCATCTCATAATATATCCGTGATT
GCTGATCTACACTTGAGCACTATTGACTGGGAAGGTACTTCTTTTAGTAATTCTCCAGCT
ATTCAAAGGAATACTTTTTCTCATGATTTAAAATCAGAAGTTGAATCAGAGCTATCAGCC
ATCCCTGATGGCTTTGAAAATATCCCAGAACAACTGTCCTGTGAATCAGAAAGGTACACT
GCAAACATAAAGAAAGTGTTGGATGAGGATTCTGATGGGATTAGTCCTGAAGAGCATCTA
CTTTCTGGCATTACTGATTTATGTCTTCAGGATTTGCCTTTAAAGGAACGAATATTTACA
AAATTATCATATCCTCAGGATAATCTACAACCAGATGTCAACCTGAAAACTTTGTCCATA
CTTAGTGTAAAAGAATCTTGTATTGCTAACAGTGGTTCTGATTGTACATCACATCTTTCA
AAGGATCTTCCAGGAATTCCCTTGCAAAATGAATCCAGAGACTCTAAAATTCTAAAAGGA
GACCAGCTGCTTCAAGAAGACTATAAAGTCAATACTTCTGTCCCTTATTCTGTCAGTAAC
ACAGTGGTAAAGACCTGCAATGTTAGACCACCAAATACTGCTTTAGATCATAGTAGAAAA
GTTGATATGCAAACCACTCGGAAAATTTTAATGAAGAAGAGTGTTTGCCTTGACAGACAT
TCCTCTGATGAACAAAGTGCCCCAGTGTTTGGGAAAGCTAAGTACACAACTCAAAGAATG
AAGCACAGTTCTCAAAAGCATAATTCATCCCATTTCAAAGAAAGTGGCCATAACAAGTTG
AGTAGCCCTAAGATACATATTAAAGAAACTGAACAGTGTGTCAGATCTTATGAAACAGCT
GAAAATGAAGAAAGCTGTTTCCCAGATTCAACAAAAAGTTCTCTGAGTTCTCTACAATGT
CATAAGAAAGAAAACAACTCTGGTACTTGTTTGGATAGCCCTCTTCCTTTACGCCAGAGA
TTAAAACTAAGATTCCAAAGCACTTGA
Protein Properties
Number of Residues 908
Molecular Weight 102883.6
Theoretical pI 7.85
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Flap endonuclease GEN homolog 1
MGVNDLWQILEPVKQHIPLRNLGGKTIAVDLSLWVCEAQTVKKMMGSVMKPHLRNLFFRI
SYLTQMDVKLVFVMEGEPPKLKADVISKRNQSRYGSSGKSWSQKTGRSHFKSVLRECLHM
LECLGIPWVQAAGEAEAMCAYLNAGGHVDGCLTNDGDTFLYGAQTVYRNFTMNTKDPHVD
CYTMSSIKSKLGLDRDALVGLAILLGCDYLPKGVPGVGKEQALKLIQILKGQSLLQRFNR
WNETSCNSSPQLLVTKKLAHCSVCSHPGSPKDHERNGCRLCKSDKYCEPHDYEYCCPCEW
HRTEHDRQLSEVENNIKKKACCCEGFPFHEVIQEFLLNKDKLVKVIRYQRPDLLLFQRFT
LEKMEWPNHYACEKLLVLLTHYDMIERKLGSRNSNQLQPIRIVKTRIRNGVHCFEIEWEK
PEHYAMEDKQHGEFALLTIEEESLFEAAYPEIVAVYQKQKLEIKGKKQKRIKPKENNLPE
PDEVMSFQSHMTLKPTCEIFHKQNSKLNSGISPDPTLPQESISASLNSLLLPKNTPCLNA
QEQFMSSLRPLAIQQIKAVSKSLISESSQPNTSSHNISVIADLHLSTIDWEGTSFSNSPA
IQRNTFSHDLKSEVESELSAIPDGFENIPEQLSCESERYTANIKKVLDEDSDGISPEEHL
LSGITDLCLQDLPLKERIFTKLSYPQDNLQPDVNLKTLSILSVKESCIANSGSDCTSHLS
KDLPGIPLQNESRDSKILKGDQLLQEDYKVNTSVPYSVSNTVVKTCNVRPPNTALDHSRK
VDMQTTRKILMKKSVCLDRHSSDEQSAPVFGKAKYTTQRMKHSSQKHNSSHFKESGHNKL
SSPKIHIKETEQCVRSYETAENEESCFPDSTKSSLSSLQCHKKENNSGTCLDSPLPLRQR
LKLRFQST
GenBank ID Protein 194018535
UniProtKB/Swiss-Prot ID Q17RS7
UniProtKB/Swiss-Prot Entry Name GEN_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001130009.1
GeneCard ID GEN1
GenAtlas ID GEN1
HGNC ID HGNC:26881
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]