You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08734
Secondary Accession Numbers
  • 14457
Name Interleukin-1 receptor-associated kinase 3
Synonyms
  1. IL-1 receptor-associated kinase M
  2. IRAK-3
  3. IRAK-M
Gene Name IRAK3
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Inhibits dissociation of IRAK1 and IRAK4 from the Toll- like receptor signaling complex by either inhibiting the phosphorylation of IRAK1 and IRAK4 or stabilizing the receptor complex
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein binding
protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
biological regulation
regulation of biological process
cellular metabolic process
regulation of cellular process
signal transduction
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 12q14.3
SNPs IRAK3
Gene Sequence
>1791 bp
ATGGCGGGGAACTGTGGGGCCCGCGGCGCGCTGTCGGCGCACACGCTGCTGTTCGACCTG
CCGCCCGCGCTGCTCGGAGAGCTCTGCGCTGTTCTGGACAGCTGCGACGGCGCGCTGGGC
TGGCGCGGCCTGGCAGAGAGACTTTCAAGCAGCTGGCTGGATGTTCGTCATATTGAAAAG
TATGTAGACCAAGGTAAAAGTGGAACAAGAGAATTACTTTGGTCCTGGGCACAGAAAAAC
AAGACCATCGGTGACCTTTTACAGGTCCTCCAGGAGATGGGACATCGTCGAGCTATTCAT
TTAATTACAAACTATGGAGCAGTGTTGAGTCCTTCAGAGAAGAGTTATCAGGAAGGTGGA
TTTCCAAATATATTATTCAAGGAAACAGCCAATGTCACCGTGGATAATGTTCTTATTCCT
GAACATAATGAAAAAGGAGTACTGCTTAAATCTTCCATCAGCTTTCAAAATATCATAGAA
GGAACTAGAAATTTCCACAAAGACTTCCTAATTGGAGAAGGAGAGATTTTTGAGGTATAC
AGAGTGGAGATTCAAAACCTAACATATGCTGTCAAATTATTTAAACAGGAGAAAAAAATG
CAGTGTAAGAAGCATTGGAAGAGGTTTTTATCTGAGCTTGAAGTTTTACTACTGTTTCAT
CACCCAAACATACTAGAGTTGGCTGCATATTTTACAGAGACTGAGAAGTTCTGTCTGATT
TATCCATACATGAGAAATGGAACACTTTTTGACAGATTGCAGTGTGTAGGTGACACGGCC
CCACTCCCTTGGCACATTCGAATCGGTATATTAATAGGAATATCCAAAGCCATTCACTAC
CTGCACAACGTTCAACCATGCTCGGTCATCTGTGGCAGTATATCAAGTGCAAACATCCTT
TTGGATGATCAGTTTCAACCCAAACTAACTGATTTTGCCATGGCACACTTCCGGTCCCAC
CTAGAACATCAGAGTTGTACCATAAATATGACCAGCAGCAGCAGTAAACATCTGTGGTAC
ATGCCAGAAGAGTACATCAGACAGGGGAAACTTTCCATTAAAACAGATGTCTACAGCTTT
GGAATTGTAATAATGGAAGTTCTAACAGGATGTAGAGTAGTGTTAGATGATCCAAAACAT
ATCCAGCTGCGGGATCTCCTTAGAGAATTGATGGAGAAGAGAGGCCTGGATTCATGTCTC
TCATTTCTAGATAAGAAAGTGCCTCCCTGCCCTCGGAATTTCTCTGCCAAGCTCTTCTGT
TTGGCAGGCCGGTGTGCTGCAACGCGGGCAAAGTTAAGACCATCAATGGATGAAGTTTTA
AATACTCTTGAAAGTACTCAAGCCAGCTTGTATTTTGCTGAAGATCCTCCCACATCACTA
AAGTCCTTCAGGTGTCCTTCTCCTCTATTCCTGGAGAATGTACCAAGTATTCCAGTGGAA
GATGATGAAAGCCAGAATAACAATTTACTACCTTCTGATGAAGGCCTGAGGATAGACAGA
ATGACTCAGAAAACTCCTTTTGAATGCAGCCAGTCTGAGGTTATGTTTCTGAGCTTGGAC
AAAAAGCCAGAGAGCAAGAGAAATGAGGAAGCTTGCAACATGCCCAGTTCTTCTTGTGAA
GAAAGTTGGTTCCCAAAGTATATAGTTCCATCCCAGGACTTAAGGCCCTATAAGGTAAAT
ATAGATCCTTCTTCAGAAGCTCCAGGGCATTCTTGCAGGAGCAGGCCAGTGGAGAGCAGC
TGTTCCTCCAAATTTTCCTGGGATGAATATGAACAGTACAAAAAAGAATAA
Protein Properties
Number of Residues 596
Molecular Weight 67752.0
Theoretical pI 6.68
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Interleukin-1 receptor-associated kinase 3
MAGNCGARGALSAHTLLFDLPPALLGELCAVLDSCDGALGWRGLAERLSSSWLDVRHIEK
YVDQGKSGTRELLWSWAQKNKTIGDLLQVLQEMGHRRAIHLITNYGAVLSPSEKSYQEGG
FPNILFKETANVTVDNVLIPEHNEKGVLLKSSISFQNIIEGTRNFHKDFLIGEGEIFEVY
RVEIQNLTYAVKLFKQEKKMQCKKHWKRFLSELEVLLLFHHPNILELAAYFTETEKFCLI
YPYMRNGTLFDRLQCVGDTAPLPWHIRIGILIGISKAIHYLHNVQPCSVICGSISSANIL
LDDQFQPKLTDFAMAHFRSHLEHQSCTINMTSSSSKHLWYMPEEYIRQGKLSIKTDVYSF
GIVIMEVLTGCRVVLDDPKHIQLRDLLRELMEKRGLDSCLSFLDKKVPPCPRNFSAKLFC
LAGRCAATRAKLRPSMDEVLNTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVE
DDESQNNNLLPSDEGLRIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPSSSCE
ESWFPKYIVPSQDLRPYKVNIDPSSEAPGHSCRSRPVESSCSSKFSWDEYEQYKKE
GenBank ID Protein 5225378
UniProtKB/Swiss-Prot ID Q9Y616
UniProtKB/Swiss-Prot Entry Name IRAK3_HUMAN
PDB IDs Not Available
GenBank Gene ID AF113136
GeneCard ID IRAK3
GenAtlas ID IRAK3
HGNC ID HGNC:17020
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  3. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  4. Wesche H, Gao X, Li X, Kirschning CJ, Stark GR, Cao Z: IRAK-M is a novel member of the Pelle/interleukin-1 receptor-associated kinase (IRAK) family. J Biol Chem. 1999 Jul 2;274(27):19403-10. [PubMed:10383454 ]
  5. Balaci L, Spada MC, Olla N, Sole G, Loddo L, Anedda F, Naitza S, Zuncheddu MA, Maschio A, Altea D, Uda M, Pilia S, Sanna S, Masala M, Crisponi L, Fattori M, Devoto M, Doratiotto S, Rassu S, Mereu S, Giua E, Cadeddu NG, Atzeni R, Pelosi U, Corrias A, Perra R, Torrazza PL, Pirina P, Ginesu F, Marcias S, Schintu MG, Del Giacco GS, Manconi PE, Malerba G, Bisognin A, Trabetti E, Boner A, Pescollderungg L, Pignatti PF, Schlessinger D, Cao A, Pilia G: IRAK-M is involved in the pathogenesis of early-onset persistent asthma. Am J Hum Genet. 2007 Jun;80(6):1103-14. Epub 2007 Apr 27. [PubMed:17503328 ]