Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08735
Secondary Accession Numbers
  • 14458
Name ATP-sensitive inward rectifier potassium channel 10
Synonyms
  1. ATP-dependent inwardly rectifying potassium channel Kir4.1
  2. Inward rectifier K(+) channel Kir1.2
  3. Potassium channel, inwardly rectifying subfamily J member 10
Gene Name KCNJ10
Protein Type Unknown
Biological Properties
General Function Involved in inward rectifier potassium channel activity
Specific Function May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
inward rectifier potassium channel activity
cation channel activity
potassium channel activity
voltage-gated potassium channel activity
Process
establishment of localization
transport
monovalent inorganic cation transport
potassium ion transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 1q23.2
SNPs KCNJ10
Gene Sequence
>1140 bp
ATGACGTCAGTTGCCAAGGTGTATTACAGTCAGACCACTCAGACAGAAAGCCGGCCCCTA
ATGGGCCCAGGGATACGACGGCGGAGAGTCCTGACAAAAGATGGTCGCAGCAACGTGAGA
ATGGAGCACATTGCCGACAAGCGCTTCCTCTACCTCAAGGACCTGTGGACAACCTTCATT
GACATGCAGTGGCGCTACAAGCTTCTGCTCTTCTCTGCGACCTTTGCAGGCACATGGTTC
CTCTTTGGCGTGGTGTGGTATCTGGTAGCTGTGGCACATGGGGACCTGCTGGAGCTGGAC
CCCCCGGCCAACCACACCCCCTGTGTGGTACAGGTGCACACACTCACTGGAGCCTTCCTC
TTCTCCCTTGAATCCCAAACCACCATTGGCTATGGCTTCCGCTACATCAGTGAGGAATGT
CCACTGGCCATTGTGCTTCTTATTGCCCAGCTGGTGCTCACCACCATCCTGGAAATCTTC
ATCACAGGTACCTTCCTGGCGAAGATTGCCCGGCCCAAGAAGCGGGCTGAGACCATTCGT
TTCAGCCAGCATGCAGTTGTGGCCTCCCACAATGGCAAGCCCTGCCTCATGATCCGAGTT
GCCAATATGCGCAAAAGCCTCCTCATTGGCTGCCAGGTGACAGGAAAACTGCTTCAGACC
CACCAAACCAAGGAAGGGGAGAACATCCGGCTCAACCAGGTCAATGTGACTTTCCAAGTA
GACACAGCCTCTGACAGCCCCTTCCTTATTCTACCCCTTACCTTCTATCATGTGGTAGAT
GAGACCAGTCCCTTGAAAGATCTCCCTCTTCGCAGTGGTGAGGGTGACTTTGAGCTGGTG
CTGATCCTAAGTGGGACAGTGGAGTCCACCAGTGCCACCTGTCAGGTGCGCACTTCCTAC
CTGCCAGAGGAGATCCTTTGGGGCTACGAGTTCACACCTGCCATCTCACTGTCAGCCAGT
GGTAAATACATAGCTGACTTTAGCCTTTTTGACCAAGTTGTGAAAGTGGCCTCTCCTAGT
GGCCTCCGTGACAGCACTGTACGCTACGGAGACCCTGAAAAGCTCAAGTTGGAGGAGTCA
TTAAGGGAGCAAGCTGAGAAGGAGGGCAGTGCCCTTAGTGTGCGCATCAGCAATGTCTGA
Protein Properties
Number of Residues 379
Molecular Weight 42507.7
Theoretical pI 8.2
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 65-89
  • 143-164
Protein Sequence
>ATP-sensitive inward rectifier potassium channel 10
MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFI
DMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFL
FSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIR
FSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQV
DTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSY
LPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEES
LREQAEKEGSALSVRISNV
GenBank ID Protein 55665330
UniProtKB/Swiss-Prot ID P78508
UniProtKB/Swiss-Prot Entry Name IRK10_HUMAN
PDB IDs Not Available
GenBank Gene ID AL513302
GeneCard ID KCNJ10
GenAtlas ID KCNJ10
HGNC ID HGNC:6256
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Shuck ME, Piser TM, Bock JH, Slightom JL, Lee KS, Bienkowski MJ: Cloning and characterization of two K+ inward rectifier (Kir) 1.1 potassium channel homologs from human kidney (Kir1.2 and Kir1.3). J Biol Chem. 1997 Jan 3;272(1):586-93. [PubMed:8995301 ]
  4. Schoots O, Wilson JM, Ethier N, Bigras E, Hebert TE, Van Tol HH: Co-expression of human Kir3 subunits can yield channels with different functional properties. Cell Signal. 1999 Dec;11(12):871-83. [PubMed:10659995 ]
  5. Bockenhauer D, Feather S, Stanescu HC, Bandulik S, Zdebik AA, Reichold M, Tobin J, Lieberer E, Sterner C, Landoure G, Arora R, Sirimanna T, Thompson D, Cross JH, van't Hoff W, Al Masri O, Tullus K, Yeung S, Anikster Y, Klootwijk E, Hubank M, Dillon MJ, Heitzmann D, Arcos-Burgos M, Knepper MA, Dobbie A, Gahl WA, Warth R, Sheridan E, Kleta R: Epilepsy, ataxia, sensorineural deafness, tubulopathy, and KCNJ10 mutations. N Engl J Med. 2009 May 7;360(19):1960-70. doi: 10.1056/NEJMoa0810276. [PubMed:19420365 ]
  6. Scholl UI, Choi M, Liu T, Ramaekers VT, Hausler MG, Grimmer J, Tobe SW, Farhi A, Nelson-Williams C, Lifton RP: Seizures, sensorineural deafness, ataxia, mental retardation, and electrolyte imbalance (SeSAME syndrome) caused by mutations in KCNJ10. Proc Natl Acad Sci U S A. 2009 Apr 7;106(14):5842-7. doi: 10.1073/pnas.0901749106. Epub 2009 Mar 16. [PubMed:19289823 ]