Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08738
Secondary Accession Numbers
  • 14461
Name ATP-sensitive inward rectifier potassium channel 14
Synonyms
  1. IRK-4
  2. Inward rectifier K(+) channel Kir2.4
  3. Potassium channel, inwardly rectifying subfamily J member 14
Gene Name KCNJ14
Protein Type Unknown
Biological Properties
General Function Involved in inward rectifier potassium channel activity
Specific Function Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. KCNJ14 gives rise to low-conductance channels with a low affinity to the channel blockers Barium and Cesium
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
inward rectifier potassium channel activity
cation channel activity
potassium channel activity
voltage-gated potassium channel activity
Process
establishment of localization
transport
monovalent inorganic cation transport
potassium ion transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13
SNPs KCNJ14
Gene Sequence
>1311 bp
ATGGGCCTGGCCAGGGCCCTACGCCGCCTCAGCGGCGCCCTGGATTCGGGAGACAGCCGG
GCGGGCGATGAAGAGGAGGCCGGGCCCGGGTTGTGCCGCAACGGGTGGGCGCCGGCACCG
GTGCAGTCACCCGTGGGCCGGCGCCGCGGTCGCTTCGTCAAGAAAGACGGGCACTGCAAC
GTGCGTTTCGTAAACCTGGGTGGCCAGGGCGCGCGCTACCTGAGCGACCTGTTCACCACA
TGCGTGGACGTGCGCTGGCGCTGGATGTGCCTGCTCTTCTCCTGCTCCTTCCTCGCCTCC
TGGCTGCTCTTCGGCCTGGCCTTCTGGCTCATTGCCTCGCTGCACGGCGACCTGGCCGCC
CCGCCACCGCCCGCGCCCTGCTTCTCACACGTGGCCAGCTTCCTGGCCGCCTTCCTCTTC
GCGCTGGAGACGCAGACGTCCATCGGCTACGGCGTGCGCAGCGTCACCGAGGAGTGCCCG
GCCGCTGTGGCCGCCGTGGTGCTGCAGTGCATTGCCGGCTGCGTGCTCGACGCCTTCGTC
GTGGGTGCTGTCATGGCCAAGATGGCCAAACCCAAGAAGCGCAACGAGACGCTGGTCTTC
AGCGAGAACGCCGTCGTGGCGCTGCGCGACCACCGCCTCTGCCTCATGTGGCGCGTCGGC
AACCTGCGCCGCAGCCACCTGGTCGAGGCCCACGTGCGTGCCCAGCTGCTGCAGCCCCGT
GTGACCCCAGAGGGTGAGTACATCCCGCTGGACCACCAGGATGTGGATGTGGGCTTTGAT
GGAGGCACCGATCGTATCTTCCTCGTGTCCCCCATCACCATCGTCCATGAGATCGACTCT
GCCAGTCCTCTGTATGAGCTAGGACGTGCCGAGCTGGCCAGGGCTGACTTTGAGCTGGTG
GTCATTCTCGAGGGGATGGTTGAGGCCACAGCCATGACCACACAGTGTCGCTCGTCCTAC
CTCCCTGGTGAACTGCTCTGGGGCCATCGTTTTGAGCCAGTTCTCTTCCAGCGTGGCTCC
CAGTATGAGGTCGACTATCGCCACTTCCATCGCACTTATGAGGTCCCAGGGACACCGGTC
TGCAGTGCTAAGGAGCTGGATGAACGGGCAGAGCAGGCTTCCCACAGCCTCAAGTCTAGT
TTCCCCGGCTCTCTGACTGCATTTTGTTATGAGAATGAACTTGCTCTGAGCTGCTGCCAG
GAGGAAGATGAGGACGATGAGACTGAGGAAGGGAATGGGGTGGAAACAGAAGATGGGGCT
GCTAGCCCCCGAGTTCTCACACCAACCCTGGCGCTGACCCTGCCTCCATGA
Protein Properties
Number of Residues 436
Molecular Weight 47845.0
Theoretical pI 5.1
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 87-111
  • 162-183
Protein Sequence
>ATP-sensitive inward rectifier potassium channel 14
MGLARALRRLSGALDSGDSRAGDEEEAGPGLCRNGWAPAPVQSPVGRRRGRFVKKDGHCN
VRFVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLAFWLIASLHGDLAA
PPPPAPCFSHVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFV
VGAVMAKMAKPKKRNETLVFSENAVVALRDHRLCLMWRVGNLRRSHLVEAHVRAQLLQPR
VTPEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADFELV
VILEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPV
CSAKELDERAEQASHSLKSSFPGSLTAFCYENELALSCCQEEDEDDETEEGNGVETEDGA
ASPRVLTPTLALTLPP
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9UNX9
UniProtKB/Swiss-Prot Entry Name IRK14_HUMAN
PDB IDs Not Available
GenBank Gene ID AF081466
GeneCard ID KCNJ14
GenAtlas ID KCNJ14
HGNC ID HGNC:6260
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Hughes BA, Kumar G, Yuan Y, Swaminathan A, Yan D, Sharma A, Plumley L, Yang-Feng TL, Swaroop A: Cloning and functional expression of human retinal kir2.4, a pH-sensitive inwardly rectifying K(+) channel. Am J Physiol Cell Physiol. 2000 Sep;279(3):C771-84. [PubMed:10942728 ]
  3. Topert C, Doring F, Derst C, Daut J, Grzeschik KH, Karschin A: Cloning, structure and assignment to chromosome 19q13 of the human Kir2.4 inwardly rectifying potassium channel gene (KCNJ14). Mamm Genome. 2000 Mar;11(3):247-9. [PubMed:10723734 ]