You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08739
Secondary Accession Numbers
  • 14462
Name ATP-sensitive inward rectifier potassium channel 15
Synonyms
  1. Inward rectifier K(+) channel Kir1.3
  2. Inward rectifier K(+) channel Kir4.2
  3. Potassium channel, inwardly rectifying subfamily J member 15
Gene Name KCNJ15
Protein Type Unknown
Biological Properties
General Function Involved in inward rectifier potassium channel activity
Specific Function Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
inward rectifier potassium channel activity
cation channel activity
potassium channel activity
voltage-gated potassium channel activity
Process
establishment of localization
transport
monovalent inorganic cation transport
potassium ion transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:2
Locus 21q22.2
SNPs KCNJ15
Gene Sequence
>1128 bp
ATGGATGCCATTCACATCGGCATGTCCAGCACCCCCCTGGTGAAGCACACTGCTGGGGCT
GGGCTCAAGGCCAACAGACCCCGCGTCATGTCCAAGAGTGGGCACAGCAACGTGAGAATT
GACAAAGTGGATGGCATATACCTACTCTACCTGCAAGACCTGTGGACCACAGTTATCGAC
ATGAAGTGGAGATACAAACTCACCCTGTTCGCTGCCACTTTTGTGATGACCTGGTTCCTT
TTTGGAGTCATCTACTATGCCATCGCGTTTATTCATGGGGACTTAGAACCCGGTGAGCCC
ATTTCAAATCATACCCCCTGCATCATGAAAGTGGACTCTCTCACTGGGGCGTTTCTCTTT
TCCCTGGAATCCCAGACAACCATTGGCTATGGAGTCCGTTCCATCACAGAGGAATGTCCT
CATGCCATCTTCCTGTTGGTTGCTCAGTTGGTCATCACGACCTTGATTGAGATCTTCATC
ACCGGAACCTTCCTGGCCAAAATCGCCAGACCCAAAAAGCGGGCTGAGACCATCAAGTTC
AGCCACTGTGCAGTCATCACCAAGCAGAATGGGAAGCTGTGCTTGGTGATTCAGGTAGCC
AATATGAGGAAGAGCCTCTTGATTCAGTGCCAGCTCTCTGGCAAGCTCCTGCAGACCCAC
GTCACCAAGGAGGGGGAGCGGATTCTCCTCAACCAAGCCACTGTCAAATTCCACGTGGAC
TCCTCCTCTGAGAGCCCCTTCCTCATTCTGCCCATGACATTCTACCATGTGCTGGATGAG
ACGAGCCCCCTGAGAGACCTCACACCCCAAAACCTAAAGGAGAAGGAGTTTGAGCTTGTG
GTCCTCCTCAATGCCACTGTGGAATCCACCAGCGCTGTCTGCCAGAGCCGAACATCTTAT
ATCCCAGAGGAAATCTACTGGGGTTTTGAGTTTGTGCCTGTGGTATCTCTCTCCAAAAAT
GGAAAATATGTGGCTGATTTCAGTCAGTTTGAACAGATTCGGAAAAGCCCAGATTGCACA
TTTTACTGTGCAGATTCTGAGAAACAGCAACTCGAGGAGAAGTACAGGCAGGAGGATCAG
AGGGAAAGAGAACTGAGGACACTTTTATTACAACAGAGCAATGTCTGA
Protein Properties
Number of Residues 375
Molecular Weight 42577.0
Theoretical pI 7.78
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 64-88
  • 142-163
Protein Sequence
>ATP-sensitive inward rectifier potassium channel 15
MDAIHIGMSSTPLVKHTAGAGLKANRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVID
MKWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPGEPISNHTPCIMKVDSLTGAFLF
SLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKF
SHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTHVTKEGERILLNQATVKFHVD
SSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSY
IPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQ
RERELRTLLLQQSNV
GenBank ID Protein 15426450
UniProtKB/Swiss-Prot ID Q99712
UniProtKB/Swiss-Prot Entry Name IRK15_HUMAN
PDB IDs Not Available
GenBank Gene ID BC013327
GeneCard ID KCNJ15
GenAtlas ID KCNJ15
HGNC ID HGNC:6261
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  3. Shuck ME, Piser TM, Bock JH, Slightom JL, Lee KS, Bienkowski MJ: Cloning and characterization of two K+ inward rectifier (Kir) 1.1 potassium channel homologs from human kidney (Kir1.2 and Kir1.3). J Biol Chem. 1997 Jan 3;272(1):586-93. [PubMed:8995301 ]
  4. Gosset P, Ghezala GA, Korn B, Yaspo ML, Poutska A, Lehrach H, Sinet PM, Creau N: A new inward rectifier potassium channel gene (KCNJ15) localized on chromosome 21 in the Down syndrome chromosome region 1 (DCR1). Genomics. 1997 Sep 1;44(2):237-41. [PubMed:9299242 ]
  5. Kurschner C, Mermelstein PG, Holden WT, Surmeier DJ: CIPP, a novel multivalent PDZ domain protein, selectively interacts with Kir4.0 family members, NMDA receptor subunits, neurexins, and neuroligins. Mol Cell Neurosci. 1998 Jun;11(3):161-72. [PubMed:9647694 ]