You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08740
Secondary Accession Numbers
  • 14463
Name Inward rectifier potassium channel 16
Synonyms
  1. Inward rectifier K(+) channel Kir5.1
  2. Potassium channel, inwardly rectifying subfamily J member 16
Gene Name KCNJ16
Protein Type Unknown
Biological Properties
General Function Involved in inward rectifier potassium channel activity
Specific Function Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. KCNJ16 may be involved in the regulation of fluid and pH balance
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
inward rectifier potassium channel activity
cation channel activity
potassium channel activity
voltage-gated potassium channel activity
Process
establishment of localization
transport
monovalent inorganic cation transport
potassium ion transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 17q24.3
SNPs KCNJ16
Gene Sequence
>1257 bp
ATGAGCTATTACGGCAGCAGCTATCATATTATCAATGCGGACGCAAAATACCCAGGCTAC
CCGCCAGAGCACATTATAGCTGAGAAGAGAAGAGCAAGAAGACGATTACTTCACAAAGAT
GGCAGCTGTAATGTCTACTTCAAGCACATTTTTGGAGAATGGGGAAGCTATGTGGTTGAC
ATCTTCACCACTCTTGTGGACACCAAGTGGCGCCATATGTTTGTGATATTTTCTTTATCT
TATATTCTCTCGTGGTTGATATTTGGCTCTGTCTTTTGGCTCATAGCCTTTCATCATGGC
GATCTATTAAATGATCCAGACATCACACCTTGTGTTGACAACGTCCATTCTTTCACAGGG
GCCTTTTTGTTCTCCCTAGAGACCCAAACCACCATAGGATATGGTTATCGCTGTGTTACT
GAAGAATGTTCTGTGGCCGTGCTCATGGTGATCCTCCAGTCCATCTTAAGTTGCATCATA
AATACCTTTATCATTGGAGCTGCCTTGGCCAAAATGGCAACTGCTCGAAAGAGAGCCCAA
ACCATTCGTTTCAGCTACTTTGCACTTATAGGTATGAGAGATGGGAAGCTTTGCCTCATG
TGGCGCATTGGTGATTTTCGGCCAAACCACGTGGTAGAAGGAACAGTTAGAGCCCAACTT
CTCCGCTATACAGAAGACAGTGAAGGGAGGATGACGATGGCATTTAAAGACCTCAAATTA
GTCAACGACCAAATCATCCTGGTCACCCCGGTAACTATTGTCCATGAAATTGACCATGAG
AGCCCTCTGTATGCCCTTGACCGCAAAGCAGTAGCCAAAGATAACTTTGAGATTTTGGTG
ACATTTATCTATACTGGTGATTCCACTGGAACATCTCACCAATCTAGAAGCTCCTATGTT
CCCCGAGAAATTCTCTGGGGCCATAGGTTTAATGATGTCTTGGAAGTTAAGAGGAAGTAT
TACAAAGTGAACTGCTTACAGTTTGAAGGAAGTGTGGAAGTATATGCCCCCTTTTGCAGT
GCCAAGCAATTGGACTGGAAAGACCAGCAGCTCCACATAGAAAAAGCACCACCAGTTCGA
GAATCCTGCACGTCGGACACCAAGGCGAGACGAAGGTCATTTAGTGCAGTTGCCATTGTC
AGCAGCTGTGAAAACCCTGAGGAGACCACCACTTCCGCCACACATGAATATAGGGAAACA
CCTTATCAGAAAGCTCTCCTGACTTTAAACAGAATCTCTGTAGAATCCCAAATGTAG
Protein Properties
Number of Residues 418
Molecular Weight 47948.6
Theoretical pI 7.94
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 71-95
  • 146-167
Protein Sequence
>Inward rectifier potassium channel 16
MSYYGSSYHIINADAKYPGYPPEHIIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVVD
IFTTLVDTKWRHMFVIFSLSYILSWLIFGSVFWLIAFHHGDLLNDPDITPCVDNVHSFTG
AFLFSLETQTTIGYGYRCVTEECSVAVLMVILQSILSCIINTFIIGAALAKMATARKRAQ
TIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQLLRYTEDSEGRMTMAFKDLKL
VNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYV
PREILWGHRFNDVLEVKRKYYKVNCLQFEGSVEVYAPFCSAKQLDWKDQQLHIEKAPPVR
ESCTSDTKARRRSFSAVAIVSSCENPEETTTSATHEYRETPYQKALLTLNRISVESQM
GenBank ID Protein 9957532
UniProtKB/Swiss-Prot ID Q9NPI9
UniProtKB/Swiss-Prot Entry Name IRK16_HUMAN
PDB IDs Not Available
GenBank Gene ID AF179353
GeneCard ID KCNJ16
GenAtlas ID KCNJ16
HGNC ID HGNC:6262
References
General References
  1. Derst C, Karschin C, Wischmeyer E, Hirsch JR, Preisig-Muller R, Rajan S, Engel H, Grzeschik K, Daut J, Karschin A: Genetic and functional linkage of Kir5.1 and Kir2.1 channel subunits. FEBS Lett. 2001 Mar 2;491(3):305-11. [PubMed:11240146 ]
  2. Liu Y, McKenna E, Figueroa DJ, Blevins R, Austin CP, Bennett PB, Swanson R: The human inward rectifier K(+) channel subunit kir5.1 (KCNJ16) maps to chromosome 17q25 and is expressed in kidney and pancreas. Cytogenet Cell Genet. 2000;90(1-2):60-3. [PubMed:11060447 ]