Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08742
Secondary Accession Numbers
  • 14465
Name Inward rectifier potassium channel 4
Synonyms
  1. HIR
  2. HIRK2
  3. HRK1
  4. Hippocampal inward rectifier
  5. IRK-3
  6. Inward rectifier K(+) channel Kir2.3
  7. Potassium channel, inwardly rectifying subfamily J member 4
Gene Name KCNJ4
Protein Type Unknown
Biological Properties
General Function Involved in inward rectifier potassium channel activity
Specific Function This receptor is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium
Pathways
  • Acebutolol Action Pathway
  • Alprenolol Action Pathway
  • Amiodarone Action Pathway
  • Amlodipine Action Pathway
  • Arbutamine Action Pathway
  • Atenolol Action Pathway
  • Betaxolol Action Pathway
  • Bevantolol Action Pathway
  • Bisoprolol Action Pathway
  • Bopindolol Action Pathway
  • Bupranolol Action Pathway
  • Carteolol Action Pathway
  • Carvedilol Action Pathway
  • Diltiazem Action Pathway
  • Disopyramide Action Pathway
  • Dobutamine Action Pathway
  • Epinephrine Action Pathway
  • Esmolol Action Pathway
  • Felodipine Action Pathway
  • Flecainide Action Pathway
  • Fosphenytoin (Antiarrhythmic) Action Pathway
  • Ibutilide Action Pathway
  • Isoprenaline Action Pathway
  • Isradipine Action Pathway
  • Labetalol Action Pathway
  • Levobunolol Action Pathway
  • Lidocaine (Antiarrhythmic) Action Pathway
  • Metipranolol Action Pathway
  • Metoprolol Action Pathway
  • Mexiletine Action Pathway
  • Muscle/Heart Contraction
  • Nadolol Action Pathway
  • Nebivolol Action Pathway
  • Nifedipine Action Pathway
  • Nimodipine Action Pathway
  • Nisoldipine Action Pathway
  • Nitrendipine Action Pathway
  • Oxprenolol Action Pathway
  • Penbutolol Action Pathway
  • Phenytoin (Antiarrhythmic) Action Pathway
  • Pindolol Action Pathway
  • Practolol Action Pathway
  • Procainamide (Antiarrhythmic) Action Pathway
  • Propranolol Action Pathway
  • Quinidine Action Pathway
  • Sotalol Action Pathway
  • Timolol Action Pathway
  • Tocainide Action Pathway
  • Verapamil Action Pathway
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
inward rectifier potassium channel activity
cation channel activity
potassium channel activity
voltage-gated potassium channel activity
Process
establishment of localization
transport
monovalent inorganic cation transport
potassium ion transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:2
Locus 22q13.1
SNPs KCNJ4
Gene Sequence
>1338 bp
ATGCACGGACACAGCCGCAACGGCCAGGCCCACGTGCCCCGGCGGAAGCGCCGCAACCGC
TTCGTCAAGAAGAACGGCCAATGCAACGTGTACTTCGCCAACCTGAGCAACAAGTCGCAG
CGCTACATGGCGGACATCTTCACCACCTGCGTGGACACGCGCTGGCGCTACATGCTCATG
ATCTTCTCCGCGGCCTTCCTTGTCTCCTGGCTCTTTTTCGGCCTCCTCTTCTGGTGTATC
GCCTTCTTCCACGGTGACCTGGAGGCCAGCCCAGGGGTGCCTGCGGCGGGGGGCCCGGCG
GCGGGTGGTGGCGGAGCAGCCCCGGTGGCCCCCAAGCCCTGCATCATGCACGTGAACGGC
TTCCTGGGTGCCTTCCTGTTCTCGGTGGAGACGCAGACGACCATCGGCTATGGGTTCCGG
TGCGTGACAGAGGAGTGCCCGCTGGCAGTCATCGCTGTGGTGGTCCAGTCCATCGTGGGC
TGCGTCATCGACTCCTTCATGATTGGCACCATCATGGCCAAGATGGCGCGGCCCAAGAAG
CGGGCGCAGACGTTGCTGTTCAGCCACCACGCGGTCATTTCGGTGCGCGACGGCAAGCTC
TGCCTCATGTGGCGCGTGGGCAACCTGCGCAAGAGCCACATTGTGGAGGCCCACGTGCGG
GCCCAGCTCATCAAGCCCTACATGACCCAGGAGGGCGAGTACCTGCCCCTGGACCAGCGG
GACCTCAACGTGGGCTATGACATCGGCCTGGACCGCATCTTCCTGGTGTCGCCCATCATC
ATTGTCCACGAGATCGACGAGGACAGCCCGCTTTATGGCATGGGCAAGGAGGAGCTGGAG
TCGGAGGACTTTGAGATCGTGGTCATCCTGGAGGGCATGGTGGAGGCCACGGCCATGACC
ACCCAGGCCCGCAGCTCCTACCTGGCCAGCGAGATCCTGTGGGGCCACCGCTTTGAGCCT
GTGGTCTTCGAGGAGAAGAGCCACTACAAGGTGGACTACTCACGTTTTCACAAGACCTAC
GAGGTGGCCGGCACGCCCTGCTGCTCGGCCCGGGAGCTGCAGGAGAGTAAGATCACCGTG
CTGCCCGCCCCACCGCCCCCTCCCAGTGCCTTCTGCTACGAGAACGAGCTGGCCCTTATG
AGCCAGGAGGAAGAGGAGATGGAGGAGGAGGCAGCTGCGGCGGCCGCGGTGGCCGCAGGC
CTGGGCCTGGAGGCGGGTTCCAAGGAGGAGGCGGGCATCATCCGGATGCTGGAGTTCGGC
AGCCACCTGGACCTGGAGCGCATGCAGGCTTCCCTCCCGCTGGACAACATCTCCTACCGC
AGGGAGTCTGCCATCTGA
Protein Properties
Number of Residues 445
Molecular Weight 49499.6
Theoretical pI 6.15
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 56-80
  • 149-170
Protein Sequence
>Inward rectifier potassium channel 4
MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLM
IFSAAFLVSWLFFGLLFWCIAFFHGDLEASPGVPAAGGPAAGGGGAAPVAPKPCIMHVNG
FLGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKK
RAQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQR
DLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMT
TQARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITV
LPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFG
SHLDLERMQASLPLDNISYRRESAI
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P48050
UniProtKB/Swiss-Prot Entry Name IRK4_HUMAN
PDB IDs Not Available
GenBank Gene ID U07364
GeneCard ID KCNJ4
GenAtlas ID KCNJ4
HGNC ID HGNC:6265
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  3. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802 ]
  4. Perier F, Radeke CM, Vandenberg CA: Primary structure and characterization of a small-conductance inwardly rectifying potassium channel from human hippocampus. Proc Natl Acad Sci U S A. 1994 Jun 21;91(13):6240-4. [PubMed:8016146 ]
  5. Tang W, Yang XC: Cloning a novel human brain inward rectifier potassium channel and its functional expression in Xenopus oocytes. FEBS Lett. 1994 Jul 18;348(3):239-43. [PubMed:8034048 ]
  6. Makhina EN, Kelly AJ, Lopatin AN, Mercer RW, Nichols CG: Cloning and expression of a novel human brain inward rectifier potassium channel. J Biol Chem. 1994 Aug 12;269(32):20468-74. [PubMed:8051145 ]