You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08744
Secondary Accession Numbers
  • 14467
Name G protein-activated inward rectifier potassium channel 2
Synonyms
  1. BIR1
  2. GIRK-2
  3. Inward rectifier K(+) channel Kir3.2
  4. KATP-2
  5. Potassium channel, inwardly rectifying subfamily J member 6
Gene Name KCNJ6
Protein Type Unknown
Biological Properties
General Function Involved in inward rectifier potassium channel activity
Specific Function This potassium channel may be involved in the regulation of insulin secretion by glucose and/or neurotransmitters acting through G-protein-coupled receptors. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
g-protein activated inward rectifier potassium channel activity
ion channel activity
inward rectifier potassium channel activity
cation channel activity
potassium channel activity
voltage-gated potassium channel activity
Process
establishment of localization
transport
monovalent inorganic cation transport
potassium ion transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:2
Locus 21q22.1|21q22.1
SNPs KCNJ6
Gene Sequence
>1272 bp
ATGGCCAAGCTGACAGAATCCATGACTAACGTCCTGGAGGGCGACTCCATGGATCAGGAC
GTCGAAAGCCCAGTGGCCATTCACCAGCCAAAGTTGCCTAAGCAGGCCAGGGATGACCTG
CCAAGACACATCAGCCGAGATCGGACCAAAAGGAAAATCCAGAGGTACGTGAGGAAAGAC
GGAAAGTGCAATGTTCATCACGGCAACGTGAGGGAGACCTATCGCTACCTGACCGATATC
TTCACCACATTAGTGGACCTGAAGTGGAGATTCAACCTATTGATTTTTGTCATGGTTTAC
ACAGTGACCTGGCTCTTTTTTGGAATGATCTGGTGGTTGATCGCATACATACGGGGAGAC
ATGGACCACATAGAGGACCCCTCCTGGACTCCTTGTGTTACCAACCTCAACGGGTTCGTC
TCTGCTTTTTTATTCTCAATAGAGACAGAAACCACCATTGGTTATGGCTACCGGGTCATC
ACAGATAAATGCCCGGAGGGAATTATTCTTCTCTTAATCCAATCTGTGTTGGGGTCCATT
GTCAATGCATTCATGGTGGGATGCATGTTTGTAAAAATCTCTCAACCCAAGAAGAGGGCA
GAGACCCTGGTCTTTTCCACCCATGCAGTGATCTCCATGCGGGATGGGAAACTGTGCCTG
ATGTTCCGGGTAGGGGACCTTAGGAATTCCCACATTGTGGAGGCTTCCATCAGAGCCAAG
TTGATCAAATCCAAACAGACCTCGGAGGGGGAGTTCATCCCGTTGAACCAGACGGATATC
AACGTAGGGTATTACACGGGGGATGACCGTCTGTTTCTGGTGTCACCGCTGATCATTAGC
CATGAAATTAACCAACAGAGTCCTTTCTGGGAGATCTCCAAAGCCCAGCTGCCCAAAGAG
GAACTGGAAATTGTGGTCATCCTAGAAGGAATGGTGGAAGCCACAGGGATGACATGCCAA
GCTCGAAGCTCCTACATCACCAGTGAGATCCTGTGGGGTTACCGGTTCACACCTGTCCTG
ACCCTGGAGGATGGGTTCTACGAAGTTGACTACAACAGCTTCCATGAGACCTATGAGACC
AGCACCCCATCCCTTAGTGCCAAAGAGCTGGCCGAGTTAGCCAGCAGGGCAGAGCTGCCC
CTGAGTTGGTCTGTATCCAGCAAACTCAACCAACATGCAGAACTGGAGACTGAAGAGGAA
GAAAAGAACCTCGAAGAGCAAACAGAAAGAAATGGTGATGTGGCAAACCTGGAGAATGAA
TCCAAAGTTTAG
Protein Properties
Number of Residues 423
Molecular Weight 48451.0
Theoretical pI 5.04
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 90-114
  • 167-188
Protein Sequence
>G protein-activated inward rectifier potassium channel 2
MAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKD
GKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIRGD
MDHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLGSI
VNAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAK
LIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKE
ELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYET
STPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENE
SKV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P48051
UniProtKB/Swiss-Prot Entry Name IRK6_HUMAN
PDB IDs Not Available
GenBank Gene ID U24660
GeneCard ID KCNJ6
GenAtlas ID KCNJ6
HGNC ID HGNC:6267
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Schoots O, Wilson JM, Ethier N, Bigras E, Hebert TE, Van Tol HH: Co-expression of human Kir3 subunits can yield channels with different functional properties. Cell Signal. 1999 Dec;11(12):871-83. [PubMed:10659995 ]
  3. Ferrer J, Nichols CG, Makhina EN, Salkoff L, Bernstein J, Gerhard D, Wasson J, Ramanadham S, Permutt A: Pancreatic islet cells express a family of inwardly rectifying K+ channel subunits which interact to form G-protein-activated channels. J Biol Chem. 1995 Nov 3;270(44):26086-91. [PubMed:7592809 ]
  4. Sakura H, Bond C, Warren-Perry M, Horsley S, Kearney L, Tucker S, Adelman J, Turner R, Ashcroft FM: Characterization and variation of a human inwardly-rectifying-K-channel gene (KCNJ6): a putative ATP-sensitive K-channel subunit. FEBS Lett. 1995 Jun 26;367(2):193-7. [PubMed:7796919 ]
  5. Tsaur ML, Menzel S, Lai FP, Espinosa R 3rd, Concannon P, Spielman RS, Hanis CL, Cox NJ, Le Beau MM, German MS, et al.: Isolation of a cDNA clone encoding a KATP channel-like protein expressed in insulin-secreting cells, localization of the human gene to chromosome band 21q22.1, and linkage studies with NIDDM. Diabetes. 1995 May;44(5):592-6. [PubMed:7729621 ]