Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08758
Secondary Accession Numbers
  • 14481
  • HMDBP09477
Name Misshapen-like kinase 1
Synonyms
  1. GCK family kinase MiNK
  2. MAPK/ERK kinase kinase kinase 6
  3. MEK kinase kinase 6
  4. MEKKK 6
  5. Misshapen/NIK-related kinase
  6. Mitogen-activated protein kinase kinase kinase kinase 6
Gene Name MINK1
Protein Type Unknown
Biological Properties
General Function Involved in small GTPase regulator activity
Specific Function Serine/threonine kinase that may play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway. May play a role in the development of the brain
Pathways Not Available
Reactions Not Available
GO Classification
Function
small gtpase regulator activity
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
enzyme regulator activity
protein kinase activity
protein serine/threonine kinase activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 17p13.2
SNPs MINK1
Gene Sequence
>3999 bp
ATGGGCGACCCAGCCCCCGCCCGCAGCCTGGACGACATCGACCTGTCCGCCCTGCGGGAC
CCTGCTGGGATCTTTGAGCTTGTGGAGGTGGTCGGCAATGGAACCTACGGACAGGTGTAC
AAGGGTCGGCATGTCAAGACGGGGCAGCTGGCTGCCATCAAGGTCATGGATGTCACGGAG
GACGAGGAGGAAGAGATCAAACAGGAGATCAACATGCTGAAAAAGTACTCTCACCACCGC
AACATCGCCACCTACTACGGAGCCTTCATCAAGAAGAGCCCCCCGGGAAACGATGACCAG
CTCTGGCTGGTGATGGAGTTCTGTGGTGCTGGTTCAGTGACTGACCTGGTAAAGAACACA
AAAGGCAACGCCCTGAAGGAGGACTGTATCGCCTATATCTGCAGGGAGATCCTCAGGGGT
CTGGCCCATCTCCATGCCCACAAGGTGATCCATCGAGACATCAAGGGGCAGAATGTGCTG
CTGACAGAGAATGCTGAGGTCAAGCTAGTGGATTTTGGGGTGAGTGCTCAGCTGGACCGC
ACCGTGGGCAGACGGAACACTTTCATTGGGACTCCCTACTGGATGGCTCCAGAGGTCATC
GCCTGTGATGAGAACCCTGATGCCACCTATGATTACAGGAGTGATATTTGGTCTCTAGGA
ATCACAGCCATCGAGATGGCAGAGGGAGCCCCCCCTCTGTGTGACATGCACCCCATGCGA
GCCCTCTTCCTCATTCCTCGGAACCCTCCGCCCAGGCTCAAGTCCAAGAAGTGGTCTAAG
AAGTTCATTGACTTCATTGACACATGTCTCATCAAGACTTACCTGAGCCGCCCACCCACG
GAGCAGCTACTGAAGTTTCCCTTCATCCGGGACCAGCCCACGGAGCGGCAGGTCCGCATC
CAGCTTAAGGACCACATTGACCGATCCCGGAAGAAGCGGGGTGAGAAAGAGGAGACAGAA
TATGAGTACAGCGGCAGCGAGGAGGAAGATGACAGCCATGGAGAGGAAGGAGAGCCAAGC
TCCATCATGAACGTGCCTGGAGAGTCGACTCTACGCCGGGAGTTTCTCCGGCTCCAGCAG
GAAAATAAGAGCAACTCAGAGGCTTTAAAACAGCAGCAGCAGCTGCAGCAGCAGCAGCAG
CGAGACCCCGAGGCACACATCAAACACCTGCTGCACCAGCGGCAGCGGCGCATAGAGGAG
CAGAAGGAGGAGCGGCGCCGCGTGGAGGAGCAACAGCGGCGGGAGCGGGAGCAGCGGAAG
CTGCAGGAGAAGGAGCAGCAGCGGCGGCTGGAGGACATGCAGGCTCTGCGGCGGGAGGAG
GAGCGGCGGCAGGCGGAGCGCGAGCAGGAATACAAGCGGAAGCAGCTGGAGGAGCAGCGG
CAGTCAGAACGTCTCCAGAGGCAGCTGCAGCAGGAGCATGCCTACCTCAAGTCCCTGCAG
CAGCAGCAACAGCAGCAGCAGCTTCAGAAACAGCAGCAGCAGCAGCTCCTGCCTGGGGAC
AGGAAGCCCCTGTACCATTATGGTCGGGGCATGAATCCCGCTGACAAACCAGCCTGGGCC
CGAGAGGTAGAAGAGAGAACAAGGATGAACAAGCAGCAGAACTCTCCCTTGGCCAAGAGC
AAGCCAGGCAGCACGGGGCCTGAGCCCCCCATCCCCCAGGCCTCCCCAGGGCCCCCAGGA
CCCCTTTCCCAGACTCCTCCTATGCAGAGGCCGGTGGAGCCCCAGGAGGGACCGCACAAG
AGCCTGGTGGCACACCGGGTCCCACTGAAGCCATATGCAGCACCTGTACCCCGATCCCAG
TCCCTGCAGGACCAGCCCACCCGAAACCTGGCTGCCTTCCCAGCCTCCCATGACCCCGAC
CCTGCCATCCCCGCACCCACTGCCACGCCCAGTGCCCGAGGAGCTGTCATCCGCCAGAAT
TCAGACCCCACCTCTGAAGGACCTGGCCCCAGCCCGAATCCCCCAGCCTGGGTCCGCCCA
GATAACGAGGCCCCACCCAAGGTGCCTCAGAGGACCTCATCTATCGCCACTGCCCTTAAC
ACCAGTGGGGCCGGAGGGTCCCGGCCAGCCCAGGCAGTCCGTGCCAGACCTCGCAGCAAC
TCCGCCTGGCAAATCTATCTGCAAAGGCGGGCAGAGCGGGGCACCCCAAAGCCTCCAGGG
CCCCCTGCTCAGCCCCCTGGCCCGCCCAACGCCTCTAGTAACCCCGACCTCAGGAGGAGC
GACCCTGGCTGGGAACGCTCGGACAGCGTCCTTCCAGCCTCTCACGGGCACCTCCCCCAG
GCTGGCTCACTGGAGCGGAACCGCGTGGGAGTCTCCTCCAAACCGGACAGCTCCCCTGTG
CTCTCCCCTGGGAATAAAGCCAAGCCCGACGACCACCGCTCACGGCCAGGCCGGCCCGCA
GACTTTGTGTTGCTGAAAGAGCGGACTCTGGACGAGGCCCCTCGGCCTCCCAAGAAGGCC
ATGGACTACTCGTCGTCCAGCGAGGAGGTGGAAAGCAGTGAGGACGACGAGGAGGAAGGC
GAAGGCGGGCCAGCAGAGGGGAGCAGAGATACCCCTGGGGGCCGCAGCGATGGGGATACA
GACAGCGTCAGCACCATGGTGGTCCACGACGTCGAGGAGATCACCGGGACCCAGCCCCCA
TACGGGGGCGGCACCATGGTGGTCCAGCGCACCCCTGAAGAGGAGCGGAACCTGCTGCAT
GCTGACAGCAATGGGTACACAAACCTGCCTGACGTGGTCCAGCCCAGCCACTCACCCACC
GAGAACAGCAAAGGCCAAAGCCCACCCTCGAAGGATGGGAGTGGTGACTACCAGTCTCGT
GGGCTGGTAAAGGCCCCTGGCAAGAGCTCGTTCACGATGTTTGTGGATCTAGGGATCTAC
CAGCCTGGAGGCAGTGGGGACAGCATCCCCATCACAGCCCTAGTGGGTGGAGAGGGCACT
CGGCTCGACCAGCTGCAGTACGACGTGAGGAAGGGTTCTGTGGTCAACGTGAATCCCACC
AACACCCGGGCCCACAGTGAGACCCCTGAGATCCGGAAGTACAAGAAGCGATTCAACTCC
GAGATCCTCTGTGCAGCCCTTTGGGGGGTCAACCTGCTGGTGGGCACGGAGAACGGGCTG
ATGTTGCTGGACCGAAGTGGGCAGGGCAAGGTGTATGGACTCATTGGGCGGCGACGCTTC
CAGCAGATGGATGTGCTGGAGGGGCTCAACCTGCTCATCACCATCTCAGGGAAAAGGAAC
AAACTGCGGGTGTATTACCTGTCCTGGCTCCGGAACAAGATTCTGCACAATGACCCAGAA
GTGGAGAAGAAGCAGGGCTGGACCACCGTGGGGGACATGGAGGGCTGCGGGCACTACCGT
GTTGTGAAATACGAGCGGATTAAGTTCCTGGTCATCGCCCTCAAGAGCTCCGTGGAGGTG
TATGCCTGGGCCCCCAAACCCTACCACAAATTCATGGCCTTCAAGTCCTTTGCCGACCTC
CCCCACCGCCCTCTGCTGGTCGACCTGACAGTAGAGGAGGGGCAGCGGCTCAAGGTCATC
TATGGCTCCAGTGCTGGCTTCCATGCTGTGGATGTCGACTCGGGGAACAGCTATGACATC
TACATCCCTGTGCACATCCAGAGCCAGATCACGCCCCATGCCATCATCTTCCTCCCCAAC
ACCGACGGCATGGAGATGCTGCTGTGCTACGAGGACGAGGGTGTCTACGTCAACACGTAC
GGGCGCATCATTAAGGATGTGGTGCTGCAGTGGGGGGAGATGCCTACTTCTGTGGCCTAC
ATCTGCTCCAACCAGATAATGGGCTGGGGTGAGAAAGCCATTGAGATCCGCTCTGTGGAG
ACGGGCCACCTCGACGGGGTCTTCATGCACAAACGAGCTCAGAGGCTCAAGTTCCTGTGT
GAGCGGAATGACAAGGTGTTTTTTGCCTCAGTCCGCTCTGGGGGCAGCAGCCAAGTTTAC
TTCATGACTCTGAACCGTAACTGCATCATGAACTGGTGA
Protein Properties
Number of Residues 1332
Molecular Weight 149820.6
Theoretical pI 7.95
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Misshapen-like kinase 1
MGDPAPARSLDDIDLSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKQEINMLKKYSHHRNIATYYGAFIKKSPPGNDDQLWLVMEFCGAGSVTDLVKNT
KGNALKEDCIAYICREILRGLAHLHAHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDIWSLGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFIDFIDTCLIKTYLSRPPTEQLLKFPFIRDQPTERQVRI
QLKDHIDRSRKKRGEKEETEYEYSGSEEEDDSHGEEGEPSSIMNVPGESTLRREFLRLQQ
ENKSNSEALKQQQQLQQQQQRDPEAHIKHLLHQRQRRIEEQKEERRRVEEQQRREREQRK
LQEKEQQRRLEDMQALRREEERRQAEREQEYKRKQLEEQRQSERLQRQLQQEHAYLKSLQ
QQQQQQQLQKQQQQQLLPGDRKPLYHYGRGMNPADKPAWAREVEERTRMNKQQNSPLAKS
KPGSTGPEPPIPQASPGPPGPLSQTPPMQRPVEPQEGPHKSLVAHRVPLKPYAAPVPRSQ
SLQDQPTRNLAAFPASHDPDPAIPAPTATPSARGAVIRQNSDPTSEGPGPSPNPPAWVRP
DNEAPPKVPQRTSSIATALNTSGAGGSRPAQAVRARPRSNSAWQIYLQRRAERGTPKPPG
PPAQPPGPPNASSNPDLRRSDPGWERSDSVLPASHGHLPQAGSLERNRVGVSSKPDSSPV
LSPGNKAKPDDHRSRPGRPADFVLLKERTLDEAPRPPKKAMDYSSSSEEVESSEDDEEEG
EGGPAEGSRDTPGGRSDGDTDSVSTMVVHDVEEITGTQPPYGGGTMVVQRTPEEERNLLH
ADSNGYTNLPDVVQPSHSPTENSKGQSPPSKDGSGDYQSRGLVKAPGKSSFTMFVDLGIY
QPGGSGDSIPITALVGGEGTRLDQLQYDVRKGSVVNVNPTNTRAHSETPEIRKYKKRFNS
EILCAALWGVNLLVGTENGLMLLDRSGQGKVYGLIGRRRFQQMDVLEGLNLLITISGKRN
KLRVYYLSWLRNKILHNDPEVEKKQGWTTVGDMEGCGHYRVVKYERIKFLVIALKSSVEV
YAWAPKPYHKFMAFKSFADLPHRPLLVDLTVEEGQRLKVIYGSSAGFHAVDVDSGNSYDI
YIPVHIQSQITPHAIIFLPNTDGMEMLLCYEDEGVYVNTYGRIIKDVVLQWGEMPTSVAY
ICSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVY
FMTLNRNCIMNW
GenBank ID Protein 27436917
UniProtKB/Swiss-Prot ID Q8N4C8
UniProtKB/Swiss-Prot Entry Name MINK1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_153827.4
GeneCard ID MINK1
GenAtlas ID MINK1
HGNC ID HGNC:17565
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  6. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  7. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  8. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  9. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  10. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196 ]
  11. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  12. Heibeck TH, Ding SJ, Opresko LK, Zhao R, Schepmoes AA, Yang F, Tolmachev AV, Monroe ME, Camp DG 2nd, Smith RD, Wiley HS, Qian WJ: An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells. J Proteome Res. 2009 Aug;8(8):3852-61. doi: 10.1021/pr900044c. [PubMed:19534553 ]
  13. Wolf-Yadlin A, Hautaniemi S, Lauffenburger DA, White FM: Multiple reaction monitoring for robust quantitative proteomic analysis of cellular signaling networks. Proc Natl Acad Sci U S A. 2007 Apr 3;104(14):5860-5. Epub 2007 Mar 26. [PubMed:17389395 ]
  14. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  15. Dan I, Watanabe NM, Kobayashi T, Yamashita-Suzuki K, Fukagaya Y, Kajikawa E, Kimura WK, Nakashima TM, Matsumoto K, Ninomiya-Tsuji J, Kusumi A: Molecular cloning of MINK, a novel member of mammalian GCK family kinases, which is up-regulated during postnatal mouse cerebral development. FEBS Lett. 2000 Mar 3;469(1):19-23. [PubMed:10708748 ]
  16. Hu Y, Leo C, Yu S, Huang BC, Wang H, Shen M, Luo Y, Daniel-Issakani S, Payan DG, Xu X: Identification and functional characterization of a novel human misshapen/Nck interacting kinase-related kinase, hMINK beta. J Biol Chem. 2004 Dec 24;279(52):54387-97. Epub 2004 Oct 6. [PubMed:15469942 ]