You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08762
Secondary Accession Numbers
  • 14485
Name Magnesium transporter MRS2 homolog, mitochondrial
Synonyms
  1. MRS2-like protein
Gene Name MRS2
Protein Type Unknown
Biological Properties
General Function Involved in ion transport
Specific Function Magnesium transporter that may mediate the influx of magnesium into the mitochondrial matrix.
Pathways Not Available
Reactions Not Available
GO Classification
Cellular Component
integral to membrane
mitochondrial inner membrane
Molecular Function
magnesium ion transmembrane transporter activity
Cellular Location
  1. Mitochondrion inner membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 6
Locus 6p22.3-p22.1
SNPs MRS2
Gene Sequence
>1332 bp
ATGGAATGCCTGCGCAGTTTACCCTGCCTCCTGCCCCGCGCGATGAGACTTCCCCGGCGG
ACGCTGTGTGCCCTGGCCTTGGACGTGACCTCTGTGGGTCCTCCCGTTGCTGCCTGCGGC
CGCCGAGCCAACCTGATTGGAAGGAGCCGAGCGGCGCAGCTTTGCGGGCCCGACCGGCTC
CGCGTGGCAGGTGAAGTGCACCGGTTTAGAACCTCTGACGTCTCTCAAGCCACTTTAGCC
AGTGTAGCCCCAGTATTTACTGTGACAAAATTTGACAAACAGGGAAACGTTACTTCTTTT
GAAAGGAAGAAAACTGAATTATACCAAGAGTTAGGTCTTCAAGCCAGAGATTTGAGATTT
CAGCATGTAATGAGTATCACAGTCAGAAACAATAGGATTATCATGAGAATGGAGTATTTG
AAAGCTGTGATAACTCCAGAGTGTCTTCTGATATTAGATTATCGTAATTTAAACTTAGAG
CAATGGCTGTTCCGGGAACTCCCTTCACAGTTGTCTGGAGAGGGTCAACTCGTTACATAC
CCTTTACCTTTTGAGTTTAGAGCTATAGAAGCACTCCTGCAATATTGGATCAACACCCTT
CAGGGGAAACTTAGCATTTTGCAGCCACTGATCCTTGAGACCTTGGATGCTTTGGTGGAC
CCCAAACATTCTTCTGTAGACAGAAGCAAACTGCACATTTTACTACAGAATGGCAAAAGT
CTATCAGAGTTAGAAACAGATATTAAAATTTTCAAAGAGTCAATTTTGGAGATCTTGGAT
GAGGAAGAGTTGCTAGAAGAGCTCTGTGTATCAAAATGGAGTGACCCACAAGTCTTTGAA
AAGAGCAGTGCTGGGATTGACCATGCAGAAGAAATGGAGTTGCTGTTGGAAAACTACTAC
CGATTGGCTGACGATCTCTCCAATGCAGCTCGTGAGCTTAGGGTGCTGATTGATGATTCA
CAAAGTATTATTTTCATTAATCTGGACAGCCACCGAAACGTGATGATGAGGTTGAATCTA
CAGCTGACCATGGGAACCTTCTCTCTTTCGCTCTTTGGACTAATGGGAGTTGCTTTTGGA
ATGAATTTGGAATCTTCCCTTGAAGAGGACCATAGAATTTTTTGGCTGATTACAGGAATT
ATGTTCATGGGAAGTGGCCTCATCTGGAGGCGCCTGCTTTCATTCCTTGGACGACAGCTA
GAAGCTCCATTGCCTCCTATGATGGCTTCTTTACCTAAAAAGACTCTTCTGGCAGATAGA
AGCATGGAATTGAAAAATAGCCTCAGACTGGATGGACTTGGATCAGGAAGGAGCATCCTA
ACAAACCGTTAG
Protein Properties
Number of Residues 443
Molecular Weight 50317.01
Theoretical pI 6.877
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Magnesium transporter MRS2 homolog, mitochondrial
MECLRSLPCLLPRAMRLPRRTLCALALDVTSVGPPVAACGRRANLIGRSRAAQLCGPDRL
RVAGEVHRFRTSDVSQATLASVAPVFTVTKFDKQGNVTSFERKKTELYQELGLQARDLRF
QHVMSITVRNNRIIMRMEYLKAVITPECLLILDYRNLNLEQWLFRELPSQLSGEGQLVTY
PLPFEFRAIEALLQYWINTLQGKLSILQPLILETLDALVDPKHSSVDRSKLHILLQNGKS
LSELETDIKIFKESILEILDEEELLEELCVSKWSDPQVFEKSSAGIDHAEEMELLLENYY
RLADDLSNAARELRVLIDDSQSIIFINLDSHRNVMMRLNLQLTMGTFSLSLFGLMGVAFG
MNLESSLEEDHRIFWLITGIMFMGSGLIWRRLLSFLGRQLEAPLPPMMASLPKKTLLADR
SMELKNSLRLDGLGSGRSILTNR
GenBank ID Protein 9858855
UniProtKB/Swiss-Prot ID Q9HD23
UniProtKB/Swiss-Prot Entry Name MRS2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF288288
GeneCard ID MRS2
GenAtlas ID MRS2
HGNC ID HGNC:13785
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Zsurka G, Gregan J, Schweyen RJ: The human mitochondrial Mrs2 protein functionally substitutes for its yeast homologue, a candidate magnesium transporter. Genomics. 2001 Mar 1;72(2):158-68. [PubMed:11401429 ]