You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08764
Secondary Accession Numbers
  • 14487
Name Crossover junction endonuclease MUS81
Synonyms Not Available
Gene Name MUS81
Protein Type Unknown
Biological Properties
General Function Involved in DNA binding
Specific Function Interacts with EME1 and EME2 to form a DNA structure- specific endonuclease with substrate preference for branched DNA structures with a 5'-end at the branch nick. Typical substrates include 3'-flap structures, replication forks and nicked Holliday junctions. May be required in mitosis for the processing of stalled or collapsed replication forks
Pathways Not Available
Reactions Not Available
GO Classification
Function
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
protein binding
nucleic acid binding
dna binding
nuclease activity
Process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
dna metabolic process
dna repair
Cellular Location
  1. Nucleus
  2. nucleolus
Gene Properties
Chromosome Location Chromosome:1
Locus 11q13
SNPs MUS81
Gene Sequence
>1656 bp
ATGGCGGCCCCGGTCCGCCTGGGCCGGAAGCGCCCGCTGCCTGCCTGTCCCAACCCGCTC
TTCGTTCGCTGGCTGACCGAGTGGCGGGACGAGGCGACCCGCAGCAGGCACCGCACGCGC
TTCGTATTTCAGAAGGCGCTGCGTTCCCTCCGACGGTACCCACTGCCGCTGCGCAGCGGG
AAGGAAGCTAAGATCCTACAGCACTTCGGAGACGGGCTCTGCCGGATGCTGGACGAGCGG
CTGCAGCGGCACCGAACATCGGGCGGTGACCATGCCCCGGACTCACCATCTGGAGAGAAC
AGTCCAGCCCCGCAGGGGCGACTTGCGGAAGTCCAGGACTCTTCCATGCCAGTTCCTGCC
CAGCCCAAAGCGGGAGGCTCTGGCAGCTACTGGCCAGCTCGGCACTCAGGAGCCCGAGTG
ATACTGCTGGTGCTCTACCGGGAGCACCTGAATCCTAATGGTCACCACTTCTTAACCAAG
GAGGAGCTGCTGCAGAGGTGTGCTCAGAAGTCCCCCAGGGTAGCCCCTGGGAGTGCCCCA
CCCTGGCCAGCCCTCCGCTCCCTCCTTCACAGGAACCTGGTCCTCAGGACACACCAGCCA
GCCAGGTACTCATTGACCCCAGAGGGCCTGGAGCTGGCCCAGAAGTTGGCCGAGTCAGAA
GGCCTGAGCTTGCTGAATGTGGGCATCGGGCCCAAGGAGCCCCCTGGGGAGGAGACAGCA
GTGCCAGGAGCAGCTTCAGCAGAGCTTGCCAGTGAAGCAGGGGTCCAGCAGCAGCCACTG
GAGCTGAGGCCTGGAGAGTACAGGGTGCTGTTGTGTGTGGACATTGGCGAGACCCGGGGG
GGCGGGCACAGGCCGGAGCTGCTCCGAGAGCTACAGCGGCTGCACGTGACCCACACGGTG
CGCAAGCTGCACGTTGGAGATTTTGTGTGGGTGGCTCAGGAGACCAATCCTAGAGACCCA
GCAAACCCTGGGGAGTTGGTACTGGATCACATTGTGGAGCGCAAGCGACTGGATGACCTT
TGCAGCAGCATCATCGACGGCCGCTTCCGGGAGCAGAAGTTCCGACTGAAGCGCTGTGGT
CTGGAGCGCCGGGTATACCTGGTGGAAGAGCATGGTTCCGTCCACAACCTCAGCCTTCCT
GAGAGCACACTGCTGCAGGCTGTCACCAACACTCAGGTCATTGATGGCTTTTTTGTGAAG
CGCACAGCAGACATTAAGGAGTCAGCCGCCTACCTGGCCCTCTTGACTCGGGGCCTGCAG
AGACTCTACCAGGGCCACACCCTACGCAGCCGCCCCTGGGGAACCCCTGGGAACCCTGAA
TCAGGGGCCATGACCTCTCCAAACCCTCTCTGCTCACTCCTCACCTTCAGTGACTTCAAC
GCAGGAGCCATCAAGAATAAGGCCCAGTCGGTGCGAGAAGTGTTTGCCCGGCAGCTGATG
CAGGTGCGCGGAGTGAGTGGGGAGAAGGCAGCAGCCCTGGTGGATCGATACAGCACCCCT
GCCAGCCTCCTGGCCGCCTATGATGCCTGTGCCACCCCCAAGGAACAAGAGACACTGCTG
AGCACCATTAAGTGTGGGCGTCTACAGAGGAATCTGGGGCCTGCTCTGAGCAGGACCTTA
TCCCAGCTCTACTGCAGCTACGGCCCCTTGACCTGA
Protein Properties
Number of Residues 551
Molecular Weight 61172.4
Theoretical pI 10.22
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Crossover junction endonuclease MUS81
MAAPVRLGRKRPLPACPNPLFVRWLTEWRDEATRSRRRTRFVFQKALRSLRRYPLPLRSG
KEAKILQHFGDGLCRMLDERLQRHRTSGGDHAPDSPSGENSPAPQGRLAEVQDSSMPVPA
QPKAGGSGSYWPARHSGARVILLVLYREHLNPNGHHFLTKEELLQRCAQKSPRVAPGSAR
PWPALRSLLHRNLVLRTHQPARYSLTPEGLELAQKLAESEGLSLLNVGIGPKEPPGEETA
VPGAASAELASEAGVQQQPLELRPGEYRVLLCVDIGETRGGGHRPELLRELQRLHVTHTV
RKLHVGDFVWVAQETNPRDPANPGELVLDHIVERKRLDDLCSSIIDGRFREQKFRLKRCG
LERRVYLVEEHGSVHNLSLPESTLLQAVTNTQVIDGFFVKRTADIKESAAYLALLTRGLQ
RLYQGHTLRSRPWGTPGNPESGAMTSPNPLCSLLTFSDFNAGAIKNKAQSVREVFARQLM
QVRGVSGEKAAALVDRYSTPASLLAAYDACATPKEQETLLSTIKCGRLQRNLGPALSRTL
SQLYCSYGPLT
GenBank ID Protein 16755672
UniProtKB/Swiss-Prot ID Q96NY9
UniProtKB/Swiss-Prot Entry Name MUS81_HUMAN
PDB IDs Not Available
GenBank Gene ID AF425646
GeneCard ID MUS81
GenAtlas ID MUS81
HGNC ID HGNC:29814
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  4. Svendsen JM, Smogorzewska A, Sowa ME, O'Connell BC, Gygi SP, Elledge SJ, Harper JW: Mammalian BTBD12/SLX4 assembles a Holliday junction resolvase and is required for DNA repair. Cell. 2009 Jul 10;138(1):63-77. doi: 10.1016/j.cell.2009.06.030. [PubMed:19596235 ]
  5. Ogrunc M, Sancar A: Identification and characterization of human MUS81-MMS4 structure-specific endonuclease. J Biol Chem. 2003 Jun 13;278(24):21715-20. Epub 2003 Apr 9. [PubMed:12686547 ]
  6. Ciccia A, Constantinou A, West SC: Identification and characterization of the human mus81-eme1 endonuclease. J Biol Chem. 2003 Jul 4;278(27):25172-8. Epub 2003 Apr 29. [PubMed:12721304 ]
  7. Blais V, Gao H, Elwell CA, Boddy MN, Gaillard PH, Russell P, McGowan CH: RNA interference inhibition of Mus81 reduces mitotic recombination in human cells. Mol Biol Cell. 2004 Feb;15(2):552-62. Epub 2003 Nov 14. [PubMed:14617801 ]
  8. Ciccia A, Ling C, Coulthard R, Yan Z, Xue Y, Meetei AR, Laghmani el H, Joenje H, McDonald N, de Winter JP, Wang W, West SC: Identification of FAAP24, a Fanconi anemia core complex protein that interacts with FANCM. Mol Cell. 2007 Feb 9;25(3):331-43. [PubMed:17289582 ]
  9. Chen XB, Melchionna R, Denis CM, Gaillard PH, Blasina A, Van de Weyer I, Boddy MN, Russell P, Vialard J, McGowan CH: Human Mus81-associated endonuclease cleaves Holliday junctions in vitro. Mol Cell. 2001 Nov;8(5):1117-27. [PubMed:11741546 ]
  10. Constantinou A, Chen XB, McGowan CH, West SC: Holliday junction resolution in human cells: two junction endonucleases with distinct substrate specificities. EMBO J. 2002 Oct 15;21(20):5577-85. [PubMed:12374758 ]
  11. Gao H, Chen XB, McGowan CH: Mus81 endonuclease localizes to nucleoli and to regions of DNA damage in human S-phase cells. Mol Biol Cell. 2003 Dec;14(12):4826-34. [PubMed:14638871 ]
  12. Zhang R, Sengupta S, Yang Q, Linke SP, Yanaihara N, Bradsher J, Blais V, McGowan CH, Harris CC: BLM helicase facilitates Mus81 endonuclease activity in human cells. Cancer Res. 2005 Apr 1;65(7):2526-31. [PubMed:15805243 ]
  13. Bae JB, Mukhopadhyay SS, Liu L, Zhang N, Tan J, Akhter S, Liu X, Shen X, Li L, Legerski RJ: Snm1B/Apollo mediates replication fork collapse and S Phase checkpoint activation in response to DNA interstrand cross-links. Oncogene. 2008 Aug 28;27(37):5045-56. doi: 10.1038/onc.2008.139. Epub 2008 May 12. [PubMed:18469862 ]
  14. Munoz IM, Hain K, Declais AC, Gardiner M, Toh GW, Sanchez-Pulido L, Heuckmann JM, Toth R, Macartney T, Eppink B, Kanaar R, Ponting CP, Lilley DM, Rouse J: Coordination of structure-specific nucleases by human SLX4/BTBD12 is required for DNA repair. Mol Cell. 2009 Jul 10;35(1):116-27. doi: 10.1016/j.molcel.2009.06.020. [PubMed:19595721 ]
  15. Fekairi S, Scaglione S, Chahwan C, Taylor ER, Tissier A, Coulon S, Dong MQ, Ruse C, Yates JR 3rd, Russell P, Fuchs RP, McGowan CH, Gaillard PH: Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases. Cell. 2009 Jul 10;138(1):78-89. doi: 10.1016/j.cell.2009.06.029. [PubMed:19596236 ]