You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08772
Secondary Accession Numbers
  • 14495
Name 5'-nucleotidase domain-containing protein 3
Synonyms
  1. GRP94-neighboring nucleotidase
Gene Name NT5DC3
Protein Type Unknown
Biological Properties
General Function Involved in hydrolase activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 12q22-q23.1
SNPs NT5DC3
Gene Sequence
>1647 bp
ATGACCATGGCAGCGGCGGCGGTGGTGGCACGCGGGGCCGGGGCGAGGGCAGCGACAGCG
GCGGCTTTGCGGGGTGGCTGCGGGACCGCGGCTCGGGGGCGGCCGTGTGCGGGCCCCGCC
CGGCCCTTGTGCACTGCACCCGGGACCGCCCCGGACATGAAGCGCTACCTGTGGGAGCGC
TACCGGGAGGCGAAGAGAAGCACAGAAGAATTGGTTCCTTCCATTATGAGCAACTTGTTG
AATCCAGATGCCATTTTCTCAAACAATGAAATGAGCCTGTCAGACATTGAAATCTATGGC
TTCGATTATGATTACACCTTGGTGTTTTATTCAAAGCACCTCCACACGCTGATATTTAAT
GCTGCACGGGACCTTCTCATCAATGAACACCGGTATCCAGCAGAAATCAGGAAGTATGAG
TATGACCCAAATTTTGCAATTCGTGGACTTCATTATGATGTACAGCGGGCAGTATTAATG
AAGATCGATGCTTTTCATTATATCCAGCTGGGAACTGTCTACAGAGGCCTCAGTGTTGTC
CCTGATGAAGAAGTCATTGAAATGTACGAGGGGTCCCACGTGCCCTTGGAGCAGATGAGT
GACTTTTACGGAAAGAGCTCTCATGGAAACACGATGAAGCAGTTCATGGACATCTTCTCC
CTGCCCGAGATGACCCTCCTGTCCTGCGTGAATGAATACTTCCTCAAGAACAACATCGAC
TATGAGCCTGTGCATCTGTACAAAGATGTCAAGGATTCAATTCGAGACGTCCACATCAAA
GGAATAATGTACAGAGCAATTGAAGCAGACATTGAAAAGTACATCTGCTATGCTGAGCAG
ACCCGCGCAGTGTTGGCCAAACTGGCTGATCATGGCAAGAAGATGTTTCTCATCACCAAT
AGCCCCAGTAGCTTTGTGGACAAAGGGATGAGTTATATCGTTGGGAAAGACTGGAGGGAC
CTGTTCGATGTGGTCATTGTTCAGGCTGAGAAGCCAAACTTCTTTAATGATAAGCGGAGG
CCTTTCCGAAAGATGAATGAGAAAGGTGTCTTACTCTGGGATAAAATCCATAAGTTGCAG
AAAGGCCAGATATACAAGCAGGGTAATTTATATGAATTTTTGAAGCTTACTGGATGGAGA
GGATCCAGAGTGTTGTATTTTGGTGACCATATATACAGTGACCTGGCGGATTTGACCCTA
AAGCATGGCTGGAGGACTGGTGCAATCATCCCAGAGTTGAGATCTGAGCTCAAAATCATG
AACACGGAGCAATACATTCAAACCATGACCTGGCTGCAGACCTTGACTGGCTTATTGGAA
CAGATGCAGGTTCACAGAGATGCTGAGTCACAGCTGGTTTTGCAGGAGTGGAAAAAGGAA
AGGAAGGAGATGCGAGAAATGACCAAGAGTTTCTTCAATGCCCAGTTTGGAAGCCTGTTC
CGCACAGACCAGAACCCAACCTACTTCCTAAGGCGCCTGTCGCGCTTCGCTGACATCTAC
ATGGCGTCTCTGAGCTGCCTCCTGAACTATGACGTCAGCCACACTTTCTACCCCCGGAGG
ACTCCACTGCAGCACGAACTGCCCGCCTGGTCAGAAAGGCCCCCCACCTTCGGAACCCCT
CTCCTGCAGGAGGCCCAGGCCAAGTAG
Protein Properties
Number of Residues 548
Molecular Weight 63419.3
Theoretical pI 8.47
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>5'-nucleotidase domain-containing protein 3
MTMAAAAVVARGAGARAATAAALRGGCGTAARGRPCAGPARPLCTAPGTAPDMKRYLWER
YREAKRSTEELVPSIMSNLLNPDAIFSNNEMSLSDIEIYGFDYDYTLVFYSKHLHTLIFN
AARDLLINEHRYPAEIRKYEYDPNFAIRGLHYDVQRAVLMKIDAFHYIQLGTVYRGLSVV
PDEEVIEMYEGSHVPLEQMSDFYGKSSHGNTMKQFMDIFSLPEMTLLSCVNEYFLKNNID
YEPVHLYKDVKDSIRDVHIKGIMYRAIEADIEKYICYAEQTRAVLAKLADHGKKMFLITN
SPSSFVDKGMSYIVGKDWRDLFDVVIVQAEKPNFFNDKRRPFRKMNEKGVLLWDKIHKLQ
KGQIYKQGNLYEFLKLTGWRGSRVLYFGDHIYSDLADLTLKHGWRTGAIIPELRSELKIM
NTEQYIQTMTWLQTLTGLLEQMQVHRDAESQLVLQEWKKERKEMREMTKSFFNAQFGSLF
RTDQNPTYFLRRLSRFADIYMASLSCLLNYDVSHTFYPRRTPLQHELPAWSERPPTFGTP
LLQEAQAK
GenBank ID Protein 72534692
UniProtKB/Swiss-Prot ID Q86UY8
UniProtKB/Swiss-Prot Entry Name NT5D3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001031701.2
GeneCard ID NT5DC3
GenAtlas ID NT5DC3
HGNC ID HGNC:30826
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Yatsuoka T, Furukawa T, Sunamura M, Matsuno S, Horii A: TU12B1-TY, a novel gene in the region at 12q22-q23.1 frequently deleted in pancreatic cancer, shows reduced expression in pancreatic cancer cells. Oncol Rep. 2004 Dec;12(6):1263-8. [PubMed:15547748 ]