You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08778
Secondary Accession Numbers
  • 14501
Name Nucleoside diphosphate-linked moiety X motif 17
Synonyms
  1. Nudix motif 17
Gene Name NUDT17
Protein Type Unknown
Biological Properties
General Function Involved in hydrolase activity
Specific Function Probably mediates the hydrolysis of some nucleoside diphosphate derivatives
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
hydrolase activity
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:1
Locus 1q21.1
SNPs NUDT17
Gene Sequence
>987 bp
ATGGCCGAGGTGCGGGTGCAGCTGCTCCTGTCCCGGCGTCCGGAGTCGGTGAGCTTCGCA
CGGAGTGTGTGTGGCCTCCTGGGAGCCGGACCAGGGCTCGGGACGTGGCCCATTCACTGC
AGCTTGAAGCGAGGACGGCTTGTCCTCTCGAGCAGGCCCTTCCCAGGCGCCTCCGCTAGG
CTTCCGCTCCAGCGACCCCCTTTCTGCCCTTTTGCGGCCCTGGAGGAGCGGCCCAGGGTC
CCTGGGGCTGAGCTGCCCACAGATCGAGGTGTGGACCTGGGTGTGGCCGTCATTCTGCAG
TCCAGCGACAAGACTGTCTTGCTAACCCGAAGGGCACGCACCCTGAGCGTTTCCCCCAAC
CTCTGGGTACCCCCGGGTGGGCACGTGGAACTTGAGGAGGAGCTGCTGGACGGAGGGCTT
CGAGAACTTTGGGAGGAGAGTGGACTACACCTGCCCCAGGGCCAGTTCTCTTGGGTCCCT
CTGGGTTTATGGGAGTCTGCCTACCCTCCTAGGCTGAGCTGGGGTTTACCCAAATACCAT
CACATTGTTCTGTATCTACTCGTGATCTCCCAGGAATCACAGCAGCAGTTGCAGGCCCGG
ATCCAACCAAACCCAAATGAGGTGAGCGCCCTTATGTGGCTGACACCAGATGTAGCTGCT
GCAGTGGCTGCCGCAGAGGATGGGACAGAGACACCCGGACTTCTCCCCCAGGACCTACCA
CCCTCTGTCCTTGCAGTGGAACTAGAGGAGGATGGAAGAGCCCGACCTCTGGTCCTGCAC
ATGTCCACCCTCCTGCGGATGATCCCAACCATGGCAGAGGACAAAGAGAGAGTCAGCACT
GGAACCAAGTTTGCCCTCAAGCTCTGGCTGCAACATCTGGGCAGAACACCCCCACCGTGT
AAAAGTGCAGCTTACCTGGACCCAGGGCCAGCAAAGGAAGAATGGAACATGGACCCTCTT
CCCCCAAACCAGGGGTCTGGAAAGTGA
Protein Properties
Number of Residues 328
Molecular Weight 35923.1
Theoretical pI 6.63
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Nucleoside diphosphate-linked moiety X motif 17
MAEVRVQLLLSRRPESVSFARSVCGLLGAGPGLGTWPIHCSLKRGRLVLSSRPFPGASAR
LPLQRPPFCPFAALEERPRVPGAELPTDRGVDLGVAVILQSSDKTVLLTRRARTLSVSPN
LWVPPGGHVELEEELLDGGLRELWEESGLHLPQGQFSWVPLGLWESAYPPRLSWGLPKYH
HIVLYLLVISQESQQQLQARIQPNPNEVSALMWLTPDVAAAVAAAEDGTETPGLLPQDLP
PSVLAVELEEDGRARPLVLHMSTLLRMIPTMAEDKERVSTGTKFALKLWLQHLGRTPPPC
KSAAYLDPGPAKEEWNMDPLPPNQGSGK
GenBank ID Protein 62543567
UniProtKB/Swiss-Prot ID P0C025
UniProtKB/Swiss-Prot Entry Name NUD17_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001012758.2
GeneCard ID NUDT17
GenAtlas ID NUDT17
HGNC ID HGNC:26618
References
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]