You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08779
Secondary Accession Numbers
  • 14502
Name 8-oxo-dGDP phosphatase NUDT18
Synonyms
  1. Nudix motif 18
  2. 2-hydroxy-dADP phosphatase
  3. 7,8-dihydro-8-oxoguanine phosphatase
  4. MutT homolog 3
  5. Nucleoside diphosphate-linked moiety X motif 18
Gene Name NUDT18
Protein Type Unknown
Biological Properties
General Function Involved in hydrolase activity
Specific Function Mediates the hydrolyzis of oxidized nucleoside diphosphate derivatives. Hydrolyzes 8-oxo-7,8-dihydroguanine (8-oxo-Gua)-containing deoxyribo- and ribonucleoside diphosphates to the monophosphates. Hydrolyzes 8-oxo-dGDP and 8-oxo-GDP with the same efficiencies. Hydrolyzes also 8-OH-dADP and 2-OH-dADP. Exhibited no or minimal hydrolyzis activity against 8-oxo-dGTP, 8-oxo-GTP, dGTP, GTP, dGDP and GDP. Probably removes oxidized guanine nucleotides from both the DNA and RNA precursor pools.
Pathways Not Available
Reactions
8-oxo-dGDP + Water → 8-Oxo-dGMP + Phosphate details
GO Classification
Biological Process
dADP catabolic process
dGDP catabolic process
GDP catabolic process
Function
catalytic activity
hydrolase activity
Molecular Function
magnesium ion binding
8-hydroxy-dADP phosphatase activity
8-oxo-dGDP phosphatase activity
8-oxo-GDP phosphatase activity
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location 8
Locus 8p21.3
SNPs NUDT18
Gene Sequence
>972 bp
ATGGCCTCGGAGGGCCTGGCGGGGGCGCTGGCTTCCGTGCTGGCTGGCCAGGGGTCCAGC
GTGCACAGCTGCGACTCGGCGCCGGCCGGGGAGCCGCCGGCGCCCGTGCGGCTGCGGAAG
AACGTGTGCTACGTGGTGCTGGCCGTGTTCCTCAGCGAGCAGGATGAGGTGCTACTGATC
CAGGAGGCCAAGAGGGAGTGCCGGGGGTCGTGGTACCTGCCTGCGGGGAGAATGGAGCCA
GGGGAGACCATCGTGGAGGCGCTGCAGCGGGAGGTGAAGGAGGAGGCGGGGCTGCACTGT
GAGCCCGAGACACTGCTGTCCGTGGAGGAGCGGGGCCCCTCCTGGGTCCGCTTCGTGTTC
CTCGCTCGCCCCACAGGTGGAATTCTCAAGACTTCCAAGGAGGCCGATGCGGAGTCCCTG
CAGGCTGCCTGGTACCCACGGACCTCCCTGCCCACTCCGCTGCGAGCCCATGACATCCTG
CACCTGGTTGAACTAGCCGCCCAGTATCGCCAGCAAGCCAGGCACCCTCTCATTCTGCCC
CAAGAGCTACCCTGTGATCTGGTCTGCCAGCGGCTCGTGGCTACCTTTACCAGCGCCCAG
ACAGTGTGGGTGTTAGTGGGCACAGTGGGGATGCCTCACTTGCCTGTCACTGCCTGTGGC
CTCGACCCTATGGAGCAGAGGGGTGGCATGAAGATGGCCGTCCTGCGGCTGCTGCAGGAG
TGTCTGACCCTGCACCACTTGGTGGTGGAGATCAAGGGGTTGCTTGGACTGCAGCACCTG
GGCCGAGATCACAGTGATGGCATCTGTTTGAATGTGCTGGTGACCGTGGCTTTTCGGAGC
CCAGGGATCCAGGATGAACCCCCAAAAGTTCGGGGTGAGAACTTCTCTTGGTGGAAGGTG
ATGGAGGAAGACCTGCAAAGCCAGCTCCTCCAGCGGCTTCAGGGATCCTCTGTTGTCCCA
GTGAACAGATAG
Protein Properties
Number of Residues 323
Molecular Weight 35500.76
Theoretical pI 6.227
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Nucleoside diphosphate-linked moiety X motif 18
MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVFLSEQDEVLLI
QEAKRECRGSWYLPAGRMEPGETIVEALQREVKEEAGLHCEPETLLSVEERGPSWVRFVF
LARPTGGILKTSKEADAESLQAAWYPRTSLPTPLRAHDILHLVELAAQYRQQARHPLILP
QELPCDLVCQRLVATFTSAQTVWVLVGTVGMPHLPVTACGLDPVEQRGGMKMAVLRLLQE
CLTLHHLVVEIKGLLGLQHLGRDHSDGICLNVLVTVAFRSPGIQDEPPKVRGENFSWWKV
MEEDLQSQLLQRLQGSSVVPVNR
GenBank ID Protein 118026927
UniProtKB/Swiss-Prot ID Q6ZVK8
UniProtKB/Swiss-Prot Entry Name NUD18_HUMAN
PDB IDs
GenBank Gene ID NM_024815.3
GeneCard ID NUDT18
GenAtlas ID NUDT18
HGNC ID HGNC:26194
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]