You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08780
Secondary Accession Numbers
  • 14503
Name Nucleoside diphosphate-linked moiety X motif 19, mitochondrial
Synonyms
  1. Nudix motif 19
Gene Name NUDT19
Protein Type Unknown
Biological Properties
General Function Involved in hydrolase activity
Specific Function Coenzyme A diphosphatase that mediates the hydrolysis of a wide range of CoA esters, including choloyl-CoA and branched- chain fatty-acyl-CoA esters. At low substrate concentrations medium and long-chain fatty-acyl-CoA esters are the primary substrates
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
hydrolase activity
Cellular Location
  1. Mitochondrion
  2. Peroxisome
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.11
SNPs NUDT19
Gene Sequence
>1128 bp
ATGAGCAGCTCCCTGCGGCCGGGCCCCAGCCGCTGGCGGCGGGCGGCCAGCATCGTCCTG
GCGGCTGGCTGGTCGCGCCCGGAGACCGCCACCCCGCCGTCGCGCCCGCCGCCGGCCGAG
GGCTTCCGGCTGCTGCTGCTGCAGCGCTCCCCGCACCAAGGCTTCATGCCGGGCGCGCAC
GTCTTCTCCGGCGGAGTGCTGGATGCGGCCGACCGCTCGGCGGACTGGCTGGGCCTCTTC
GCGCCGCACCACGGGCCGCCGCGCTTCGGCCTGGGCCCGGCGCCATTCAGCCGCACCGCT
TTCCCGTCGCTGCCCGACACCGATGACCACAAGACCGACAACACTGGGACGCTGCCTGAG
GACGTAGCCTTCCGCATCTGCGCCGTGCGGGAGGCCTTTGAGGAGGCGGGCGTGCTGCTG
CTGCGGCCCAGGACTTCCCCACCAGGCCCAGCACCCGGGCCTGGCCTCGCCCTGGAGCCA
CCGCCGGGCCTGGCCTCCTGGCGCGACCGCGTGCGCCAGGACCCGCGCCACTTCCTGCGG
CTGTGCGCCCACCTCGACTGCACACCCGACATCTGGGCGCTGCACAACTGGAGCGCCTGG
CTCACCCCTTTCTTGCGGGGCACCACTCGCCGCTTTGACACGGCCTTCTTCCTGTGCTGC
CTGCGCGAGCCGCCGCCCGTCTACCCCGACTTGGCGGAGGTGGTGGGCTACCAGTGGTCA
TCTCCATCAGAGGCAACTGAAAGTTTCTTATCAAAAGAAATTTGGTTGCCACCCCCACAG
TTCTACGAAGTGAGAAGACTTGCAAACTTTGCCTCTCTCTCTGACTTGCACAAATTTTGT
TTGGGTCGTGCATTAGAAGGACTGGAAAGGTGGCTGCCGATCATCTTGTTAACTGCTGAT
GGGATGGTCCATCTTTTACCAGGTGATGAGCTATATTTAGAAGATTCAGACTTTTTGGAA
AATCTTATGTCTACTGAAAAAAAGACTGAGGAAATCATGAAGGAAGGCAAGCAGTTTCAC
CGGATAGTGACATACCATCGCCACCTTTATGATATCCACGTGACTGTTCAGCCAAAGTAT
AAACACGTTTATCCTAAGAACTCTGTAGTAAGAAAAAGCCATTTGTAG
Protein Properties
Number of Residues 375
Molecular Weight 42232.8
Theoretical pI 7.7
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Nucleoside diphosphate-linked moiety X motif 19, mitochondrial
MSSSLRPGPSRWRRAASIVLAAGWSRPETATPPSRPPPAEGFRLLLLQRSPHQGFMPGAH
VFSGGVLDAADRSADWLGLFAPHHGPPRFGLGPAPFSRTAFPSLPDTDDHKTDNTGTLPE
DVAFRICAVREAFEEAGVLLLRPRTSPPGPAPGPGLALEPPPGLASWRDRVRQDPRHFLR
LCAHLDCTPDIWALHNWSAWLTPFLRGTTRRFDTAFFLCCLREPPPVYPDLAEVVGYQWS
SPSEATESFLSKEIWLPPPQFYEVRRLANFASLSDLHKFCLGRALEGLERWLPIILLTAD
GMVHLLPGDELYLEDSDFLENLMSTEKKTEEIMKEGKQFHRIVTYHRHLYDIHVTVQPKY
KHVYPKNSVVRKSHL
GenBank ID Protein 157739940
UniProtKB/Swiss-Prot ID A8MXV4
UniProtKB/Swiss-Prot Entry Name NUD19_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001105570.1
GeneCard ID NUDT19
GenAtlas ID NUDT19
HGNC ID HGNC:32036
References
General References
  1. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]