You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08782
Secondary Accession Numbers
  • 14505
Name Diphosphoinositol polyphosphate phosphohydrolase 2
Synonyms
  1. DIPP-2
  2. Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 2
  3. Nucleoside diphosphate-linked moiety X motif 4
  4. Nudix motif 4
Gene Name NUDT4
Protein Type Unknown
Biological Properties
General Function Involved in hydrolase activity
Specific Function Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), PP-InsP4 and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphate Ap6A, but not Ap5A. The major reaction products are ADP and p4a from Ap6A. Also able to hydrolyze 5-phosphoribose 1-diphosphate.
Pathways Not Available
Reactions
Diphospho-myo-inositol polyphosphate + Water → myo-inositol polyphosphate + Phosphoric acid details
GO Classification
Biological Process
calcium-mediated signaling
cyclic nucleotide metabolic process
cyclic-nucleotide-mediated signaling
intracellular transport
regulation of RNA export from nucleus
Cellular Component
intracellular
cytoplasm
Function
catalytic activity
hydrolase activity
Molecular Function
diphosphoinositol-polyphosphate diphosphatase activity
inositol diphosphate tetrakisphosphate diphosphatase activity
inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 1-diphosphatase activity
inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity
inositol-1-diphosphate-2,3,4,5,6-pentakisphosphate diphosphatase activity
inositol-3,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity
inositol-3-diphosphate-1,2,4,5,6-pentakisphosphate diphosphatase activity
inositol-5-diphosphate-1,2,3,4,6-pentakisphosphate diphosphatase activity
metal ion binding
snoRNA binding
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 12
Locus 12q21
SNPs NUDT4
Gene Sequence
>543 bp
ATGATGAAGTTCAAGCCCAACCAGACGCGGACCTACGACCGCGAGGGCTTCAAGAAGCGG
GCGGCGTGCCTGTGCTTCCGGAGCGAGCAGGAGGACGAGGTGCTGCTGGTGAGTAGCAGC
CGGTACCCAGACCAGTGGATTGTCCCAGGAGGAGGAATGGAACCCGAGGAGGAACCTGGC
GGTGCTGCCGTGAGGGAAGTTTATGAGGAGGCTGGAGTCAAAGGAAAACTAGGCAGACTT
CTGGGCATATTTGAGAACCAAGACCGAAAGCACAGAACATATGTTTATGTTCTAACAGTC
ACTGAAATATTAGAAGATTGGGAAGATTCTGTTAATATTGGAAGGAAGAGAGAGTGGTTC
AAAGTAGAAGATGCTATCAAAGTTCTCCAGTGTCATAAACCTGTACATGCAGAGTATCTG
GAAAAGCTAAAGCTGGGTTGTTCCCCAGCCAATGGAAATTCTACAGTCCCTTCCCTTCCG
GATAATAATGCCTTGTTTGTAACCGCTGCACAGACCTCTGGGTTGCCATCTAGTGTAAGA
TAG
Protein Properties
Number of Residues 180
Molecular Weight 20305.895
Theoretical pI 6.351
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Diphosphoinositol polyphosphate phosphohydrolase 2
MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPG
GAAVREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWF
KVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR
GenBank ID Protein 40317632
UniProtKB/Swiss-Prot ID Q9NZJ9
UniProtKB/Swiss-Prot Entry Name NUDT4_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_019094.4
GeneCard ID NUDT4
GenAtlas ID NUDT4
HGNC ID HGNC:8051
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Seki N, Ohira M, Nagase T, Ishikawa K, Miyajima N, Nakajima D, Nomura N, Ohara O: Characterization of cDNA clones in size-fractionated cDNA libraries from human brain. DNA Res. 1997 Oct 31;4(5):345-9. [PubMed:9455484 ]
  5. Leslie NR, McLennan AG, Safrany ST: Cloning and characterisation of hAps1 and hAps2, human diadenosine polyphosphate-metabolising Nudix hydrolases. BMC Biochem. 2002 Jul 16;3:20. [PubMed:12121577 ]
  6. Fisher DI, Safrany ST, Strike P, McLennan AG, Cartwright JL: Nudix hydrolases that degrade dinucleoside and diphosphoinositol polyphosphates also have 5-phosphoribosyl 1-pyrophosphate (PRPP) pyrophosphatase activity that generates the glycolytic activator ribose 1,5-bisphosphate. J Biol Chem. 2002 Dec 6;277(49):47313-7. Epub 2002 Oct 4. [PubMed:12370170 ]
  7. Caffrey JJ, Safrany ST, Yang X, Shears SB: Discovery of molecular and catalytic diversity among human diphosphoinositol-polyphosphate phosphohydrolases. An expanding Nudt family. J Biol Chem. 2000 Apr 28;275(17):12730-6. [PubMed:10777568 ]