Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08783
Secondary Accession Numbers
  • 14506
Name Peroxisomal coenzyme A diphosphatase NUDT7
Synonyms
  1. Nucleoside diphosphate-linked moiety X motif 7
  2. Nudix motif 7
Gene Name NUDT7
Protein Type Unknown
Biological Properties
General Function Involved in hydrolase activity
Specific Function Coenzyme A diphosphatase which mediates the cleavage of CoA, CoA esters and oxidized CoA with similar efficiencies, yielding 3',5'-ADP and the corresponding 4'-phosphopantetheine derivative as products. CoA into 3',5'-ADP and 4'- phosphopantetheine. Has no activity toward NDP-sugars, CDP- alcohols, (deoxy)nucleoside 5'-triphosphates, nucleoside 5'-di or monophosphates, diadenosine polyphosphates, NAD, NADH, NADP, NADPH or thymidine-5'-monophospho-p-nitrophenyl ester. May be required to eliminate oxidized CoA from peroxisomes, or regulate CoA and acyl-CoA levels in this organelle in response to metabolic demand
Pathways Not Available
Reactions Not Available
GO Classification
Function
manganese ion binding
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
transition metal ion binding
magnesium ion binding
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
Process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
nucleoside diphosphate metabolic process
Cellular Location
  1. Peroxisome
Gene Properties
Chromosome Location Chromosome:1
Locus 16q23.1
SNPs NUDT7
Gene Sequence
>717 bp
ATGTCACGACTTGGTCTTCCCGAGGAGCCAGTCAGAAACAGTTTGCTAGATGATGCTAAG
GCCCGCTTAAGAAAGTATGATATTGGAGGCAAATATTCTCACTTGCCATATAACAAATAC
TCCGTCCTTTTGCCATTGGTGGCTAAAGAAGGAAAACTCCATTTGTTGTTCACCGTCCGG
TCAGAGAAGCTAAGAAGGGCCCCTGGAGAAGTTTGCTTCCCTGGAGGTAAGCGTGACCCT
ACAGACATGGATGATGCAGCCACAGCTCTCCGGGAAGCCCAGGAGGAAGTGGGTCTCCGT
CCTCACCAAGTGGAAGTTGTCTGCTGCCTGGTGCCATGTCTTATTGATACAGATACATTG
ATAACTCCATTTGTGGGTTTAATAGACCACAACTTCCAGGCCCAGCCGAATCCTGCTGAA
GTTAAGGATGTATTCCTGGTGCCTCTGGCCTATTTCCTGCATCCACAGGTCCATGACCAG
CATTACGTCACACGTCTTGGTCACCGTTTTATTAATCATATCTTTGAGTACACAAACCCT
GAAGACGGTGTCACTTACCAGATCAAGGGAATGACGGCAAACCTTGCAGTGTTGGTGGCC
TTTATCATTTTGGAAAAAAAACCCACCTTTGAGGTTCAATTTAATCTTAATGATGTATTA
GCATCCTCTGAAGAGTTATTCCTGAAGGTTCATAAAAAAGCTACAAGCAGGTTATGA
Protein Properties
Number of Residues 238
Molecular Weight 26941.9
Theoretical pI 7.06
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Peroxisomal coenzyme A diphosphatase NUDT7
MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVR
SEKLRRAPGEVCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLVPCLIDTDTL
ITPFVGLIDHNFQAQPNPAEVKDVFLVPLAYFLHPQVHDQHYVTRLGHRFINHIFEYTNP
EDGVTYQIKGMTANLAVLVAFIILEKKPTFEVQFNLNDVLASSEELFLKVHKKATSRL
GenBank ID Protein 157785656
UniProtKB/Swiss-Prot ID P0C024
UniProtKB/Swiss-Prot Entry Name NUDT7_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001105663.1
GeneCard ID NUDT7
GenAtlas ID NUDT7
HGNC ID HGNC:8054
References
General References
  1. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. [PubMed:15616553 ]
  2. Gasmi L, McLennan AG: The mouse Nudt7 gene encodes a peroxisomal nudix hydrolase specific for coenzyme A and its derivatives. Biochem J. 2001 Jul 1;357(Pt 1):33-8. [PubMed:11415433 ]