Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08784
Secondary Accession Numbers
  • 14507
Name Nucleoside diphosphate-linked moiety X motif 8, mitochondrial
Synonyms
  1. Nudix motif 8
Gene Name NUDT8
Protein Type Unknown
Biological Properties
General Function Involved in hydrolase activity
Specific Function Probably mediates the hydrolysis of some nucleoside diphosphate derivatives
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
hydrolase activity
Cellular Location
  1. Mitochondrion
Gene Properties
Chromosome Location Chromosome:1
Locus 11q13.2
SNPs NUDT8
Gene Sequence
>711 bp
ATGCTGCCCGACTGCCTGTCGGCCGAGGGCGAGCTGCGCTGCCGCCGGCTGCTGGCAGGG
GCCACGGCCCGGCTCCGCGCGCGGCCCGCGTCGGCCGCGGTGCTCGTGCCGCTCTGCTCA
GTGCGTGGGGTCCCGGCGCTGCTGTACACGCTGCGGTCCAGCCGCCTGACCGGGAGGCAC
AAGGGCGACGTCAGTTTCCCAGGCGGCAAGTGCGACCCGGCTGACCAAGATGTGGTGCAC
ACGGCCCTGCGGGAAACCCGGGAGGAGCTGGGCCTGGCAGTGCCCGAGGAGCACGTGTGG
GGCCTGCTGCGGCCTGTGTATGATCCGCAAAAGGCCACCGTGGTGCCAGTGCTTGCTGGT
GTAGGCCCACTGGATCCCCAGAGCCTCAGGCCCAACTCGGAGGAGGTAGATGAGGTGTTT
GCACTGCCGCTGGCCCACCTGCTGCAGACGCAGAATCAGGGCTATACCCACTTCTGCCGG
GGTGGCCACTTCCGCTACACACTACCCGTCTTCCTGCATGGACCACACCGGGTCTGGGGC
CTCACAGCTGTCATCACTGAGTTTGCCCTGCAGCTGCTGGCACCTGGTACCTACCAGCCC
CGCCTGGCCGGCCTGACCTGCTCAGGGGCTGAGGGTCTGGCCCGCCCTAAGCAGCCCCTG
GCTTCACCCTGTCAGGCCAGCTCCACTCCAGGACTGAATAAAGGTCTTTGA
Protein Properties
Number of Residues 236
Molecular Weight 25370.0
Theoretical pI 8.5
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Nucleoside diphosphate-linked moiety X motif 8, mitochondrial
MLPDCLSAEGELRCRRLLAGATARLRARPASAAVLVPLCSVRGVPALLYTLRSSRLTGRH
KGDVSFPGGKCDPADQDVVHTALRETREELGLAVPEEHVWGLLRPVYDPQKATVVPVLAG
VGPLDPQSLRPNSEEVDEVFALPLAHLLQTQNQGYTHFCRGGHFRYTLPVFLHGPHRVWG
LTAVITEFALQLLAPGTYQPRLAGLTCSGAEGLARPKQPLASPCQASSTPGLNKGL
GenBank ID Protein 34529139
UniProtKB/Swiss-Prot ID Q8WV74
UniProtKB/Swiss-Prot Entry Name NUDT8_HUMAN
PDB IDs Not Available
GenBank Gene ID AK123561
GeneCard ID NUDT8
GenAtlas ID NUDT8
HGNC ID HGNC:8055
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]