Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08792
Secondary Accession Numbers
  • 14515
Name Protein phosphatase 1A
Synonyms
  1. PP2C-alpha
  2. Protein phosphatase 2C isoform alpha
  3. Protein phosphatase IA
Gene Name PPM1A
Protein Type Unknown
Biological Properties
General Function Involved in catalytic activity
Specific Function Enzyme with a broad specificity. Negatively regulates TGF-beta signaling through dephosphorylating SMAD2 and SMAD3, resulting in their dissociation from SMAD4, nuclear export of the SMADs and termination of the TGF-beta-mediated signaling.
Pathways
  • MAPK signaling pathway
Reactions
A phosphoprotein + Water → a protein + Phosphate details
GO Classification
Biological Process
cell cycle arrest
insulin receptor signaling pathway
Wnt receptor signaling pathway
positive regulation of transcription, DNA-dependent
negative regulation of transcription from RNA polymerase II promoter
positive regulation of I-kappaB kinase/NF-kappaB cascade
negative regulation of transforming growth factor beta receptor signaling pathway
transforming growth factor beta receptor signaling pathway
peptidyl-threonine dephosphorylation
transcription initiation from RNA polymerase II promoter
negative regulation of SMAD protein complex assembly
positive regulation of Wnt receptor signaling pathway
Cellular Component
cytosol
nucleoplasm
neuron projection
voltage-gated calcium channel complex
Component
macromolecular complex
protein complex
protein serine/threonine phosphatase complex
Function
phosphoprotein phosphatase activity
manganese ion binding
ion binding
cation binding
metal ion binding
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
transition metal ion binding
phosphoric ester hydrolase activity
phosphatase activity
magnesium ion binding
protein serine/threonine phosphatase activity
Molecular Function
manganese ion binding
magnesium ion binding
signal transducer activity
calmodulin-dependent protein phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location 14
Locus 14q23.1
SNPs PPM1A
Gene Sequence
>1149 bp
ATGGGAGCATTTTTAGACAAGCCAAAGATGGAAAAGCATAATGCCCAGGGGCAGGGTAAT
GGGTTGCGATATGGGCTAAGCAGCATGCAAGGCTGGCGTGTTGAAATGGAGGATGCACAT
ACGGCTGTGATCGGTTTGCCAAGTGGACTTGAATCGTGGTCATTCTTTGCTGTGTATGAT
GGGCATGCTGGTTCTCAGGTTGCCAAATACTGCTGTGAGCATTTGTTAGATCACATCACC
AATAACCAGGATTTTAAAGGGTCTGCAGGAGCACCTTCTGTGGAAAATGTAAAGAATGGA
ATCAGAACAGGTTTTCTGGAGATTGATGAACACATGAGAGTTATGTCAGAGAAGAAACAT
GGTGCAGATAGAAGTGGGTCAACAGCTGTAGGTGTCTTAATTTCTCCCCAACATACTTAT
TTCATTAACTGTGGAGACTCAAGAGGTTTACTTTGTAGGAACAGGAAAGTTCATTTCTTC
ACACAAGATCACAAACCAAGTAATCCGCTGGAGAAAGAACGAATTCAGAATGCAGGTGGC
TCTGTAATGATTCAGCGTGTGAATGGCTCTCTGGCTGTATCGAGGGCCCTTGGGGATTTT
GATTACAAATGCGTCCATGGAAAAGGTCCTACTGAGCAGCTTGTCTCACCAGAGCCTGAA
GTCCATGATATTGAAAGATCTGAAGAAGATGATCAGTTCATTATCCTTGCATGTGATGGT
ATCTGGGATGTTATGGGAAATGAAGAGCTCTGTGATTTTGTAAGATCCAGACTTGAAGTC
ACTGATGACCTTGAGAAAGTTTGCAATGAAGTAGTCGACACCTGTTTGTATAAGGGAAGT
CGAGACAACATGAGTGTGATTTTGATCTGTTTTCCAAATGCACCCAAAGTATCGCCAGAA
GCAGTGAAGAAGGAGGCAGAGTTGGACAAGTACCTGGAATGCAGAGTAGAAGAAATCATA
AAGAAGCAGGGGGAAGGCGTCCCCGACTTAGTCCATGTGATGCGCACATTAGCGAGTGAG
AACATCCCCAGCCTCCCACCAGGGGGTGAATTGGCAAGCAAGAGGAATGTTATTGAAGCC
GTTTACAATAGACTGAATCCTTACAAAAATGACGACACTGACTCTACATCAACAGATGAT
ATGTGGTAA
Protein Properties
Number of Residues 382
Molecular Weight 42447.455
Theoretical pI 5.363
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Protein phosphatase 1A
MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYD
GHAGSQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKH
GADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGG
SVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDG
IWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPE
AVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEA
VYNRLNPYKNDDTDSTSTDDMW
GenBank ID Protein 197692195
UniProtKB/Swiss-Prot ID P35813
UniProtKB/Swiss-Prot Entry Name PPM1A_HUMAN
PDB IDs
GenBank Gene ID AB451247
GeneCard ID PPM1A
GenAtlas ID PPM1A
HGNC ID HGNC:9275
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Goshima N, Kawamura Y, Fukumoto A, Miura A, Honma R, Satoh R, Wakamatsu A, Yamamoto J, Kimura K, Nishikawa T, Andoh T, Iida Y, Ishikawa K, Ito E, Kagawa N, Kaminaga C, Kanehori K, Kawakami B, Kenmochi K, Kimura R, Kobayashi M, Kuroita T, Kuwayama H, Maruyama Y, Matsuo K, Minami K, Mitsubori M, Mori M, Morishita R, Murase A, Nishikawa A, Nishikawa S, Okamoto T, Sakagami N, Sakamoto Y, Sasaki Y, Seki T, Sono S, Sugiyama A, Sumiya T, Takayama T, Takayama Y, Takeda H, Togashi T, Yahata K, Yamada H, Yanagisawa Y, Endo Y, Imamoto F, Kisu Y, Tanaka S, Isogai T, Imai J, Watanabe S, Nomura N: Human protein factory for converting the transcriptome into an in vitro-expressed proteome,. Nat Methods. 2008 Dec;5(12):1011-7. [PubMed:19054851 ]
  4. Mann DJ, Campbell DG, McGowan CH, Cohen PT: Mammalian protein serine/threonine phosphatase 2C: cDNA cloning and comparative analysis of amino acid sequences. Biochim Biophys Acta. 1992 Feb 28;1130(1):100-4. [PubMed:1311954 ]
  5. Takekawa M, Maeda T, Saito H: Protein phosphatase 2Calpha inhibits the human stress-responsive p38 and JNK MAPK pathways. EMBO J. 1998 Aug 17;17(16):4744-52. [PubMed:9707433 ]
  6. Das AK, Helps NR, Cohen PT, Barford D: Crystal structure of the protein serine/threonine phosphatase 2C at 2.0 A resolution. EMBO J. 1996 Dec 16;15(24):6798-809. [PubMed:9003755 ]