You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08793
Secondary Accession Numbers
  • 14516
  • HMDBP09426
Name Protein phosphatase 1B
Synonyms
  1. PP2C-beta
  2. Protein phosphatase 2C isoform beta
Gene Name PPM1B
Protein Type Unknown
Biological Properties
General Function Involved in catalytic activity
Specific Function Enzyme with a broad specificity. Dephosphorylates CDK2 and CDK6 in vitro.
Pathways
  • MAPK signaling pathway
Reactions
A phosphoprotein + Water → a protein + Phosphate details
GO Classification
Biological Process
cytokine-mediated signaling pathway
peptidyl-threonine dephosphorylation
Cellular Component
cytosol
Component
macromolecular complex
protein complex
protein serine/threonine phosphatase complex
Function
phosphoprotein phosphatase activity
manganese ion binding
ion binding
cation binding
metal ion binding
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
transition metal ion binding
phosphoric ester hydrolase activity
phosphatase activity
magnesium ion binding
protein serine/threonine phosphatase activity
Molecular Function
protein serine/threonine phosphatase activity
manganese ion binding
magnesium ion binding
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location 2
Locus 2p21
SNPs PPM1B
Gene Sequence
>1440 bp
ATGGGTGCATTTTTGGATAAACCCAAAACTGAAAAACATAATGCTCATGGTGCTGGGAAT
GGTTTACGTTATGGCCTGAGCAGCATGCAAGGATGGAGAGTGGAAATGGAAGATGCACAC
ACAGCTGTTGTAGGTATTCCTCACGGCTTGGAAGACTGGTCATTTTTTGCAGTTTATGAT
GGTCATGCTGGATCCCGAGTGGCAAATTACTGCTCAACACATTTATTAGAACACATCACT
ACTAACGAAGACTTTAGGGCAGCTGGAAAATCAGGATCTGCTCTTGAGCTTTCAGTGGAA
AATGTTAAGAATGGTATCAGAACTGGATTTTTGAAAATTGATGAATACATGCGTAACTTT
TCAGACCTCAGAAACGGGATGGACAGGAGTGGTTCAACTGCAGTGGGAGTTATGATTTCA
CCTAAGCATATCTACTTTATCAACTGTGGTGATTCACGTGCTGTTCTGTATAGGAATGGA
CAAGTCTGCTTTTCTACCCAGGATCACAAACCTTGCAATCCAAGGGAAAAGGAGCGAATC
CAAAATGCAGGAGGCAGCGTGATGATACAACGTGTTAATGGTTCATTAGCAGTATCTCGT
GCTCTGGGGGACTATGATTACAAGTGTGTTGATGGCAAGGGCCCAACAGAACAACTTGTT
TCTCCAGAGCCTGAGGTTTATGAAATTTTAAGAGCAGAAGAGGATGAATTTATCATCTTG
GCTTGTGATGGGATCTGGGATGTTATGAGTAATGAGGAGCTCTGTGAATATGTTAAATCT
AGGCTTGAGGTATCTGATGACCTGGAAAATGTGTGCAATTGGGTAGTGGACACTTGTTTA
CACAAGGGAAGTCGAGATAACATGAGTATTGTACTAGTTTGCTTTTCAAATGCTCCCAAG
GTCTCAGATGAAGCGGTGAAAAAAGATTCAGAGTTGGATAAGCACTTGGAATCACGGGTT
GAAGAGATTATGGAGAAGTCTGGCGAGGAAGGAATGCCTGATCTTGCCCATGTCATGCGC
ATCTTGTCTGCAGAAAATATCCCAAATTTGCCTCCTGGGGGAGGTCTTGCTGGCAAGCGT
AATGTTATTGAAGCTGTTTATAGTAGACTGAATCCACATAGAGAAAGTGATGGGGCCTCC
GATGAAGCAGAGGAAAGTGGATCACAGGGAAAATTGGTGGAAGCTCTCAGGCAAATGAGA
ATTAATCATAGGGGAAACTACCGACAACTTCTGGAGGAGATGCTGACTAGTTACAGGCTA
GCTAAAGTAGAGGGAGAAGAAAGCCCTGCTGAACCAGCTGCCACAGCTACTTCTTCGAAC
AGTGATGCTGGAAACCCAGTGACAATGCAGGAAAGCCATACTGAATCAGAAAGTGGTCTT
GCTGAATTAGACAGCTCTAATGAAGATGCAGGGACAAAGATGAGTGGTGAAAAAATATGA
Protein Properties
Number of Residues 479
Molecular Weight 36312.44
Theoretical pI 5.468
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Protein phosphatase 1B
MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYD
GHAGSRVANYCSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNF
SDLRNGMDRSGSTAVGVMISPKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERI
QNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEILRAEEDEFIIL
ACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSIVLVCFSNAPK
VSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKR
NVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRL
AKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI
GenBank ID Protein 4505995
UniProtKB/Swiss-Prot ID O75688
UniProtKB/Swiss-Prot Entry Name PPM1B_HUMAN
PDB IDs
GenBank Gene ID NM_002706.4
GeneCard ID PPM1B
GenAtlas ID PPM1B
HGNC ID HGNC:9276
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Hu RM, Han ZG, Song HD, Peng YD, Huang QH, Ren SX, Gu YJ, Huang CH, Li YB, Jiang CL, Fu G, Zhang QH, Gu BW, Dai M, Mao YF, Gao GF, Rong R, Ye M, Zhou J, Xu SH, Gu J, Shi JX, Jin WR, Zhang CK, Wu TM, Huang GY, Chen Z, Chen MD, Chen JL: Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning. Proc Natl Acad Sci U S A. 2000 Aug 15;97(17):9543-8. [PubMed:10931946 ]
  3. Marley AE, Kline A, Crabtree G, Sullivan JE, Beri RK: The cloning expression and tissue distribution of human PP2Cbeta. FEBS Lett. 1998 Jul 10;431(1):121-4. [PubMed:9684878 ]
  4. Cheng A, Kaldis P, Solomon MJ: Dephosphorylation of human cyclin-dependent kinases by protein phosphatase type 2C alpha and beta 2 isoforms. J Biol Chem. 2000 Nov 3;275(44):34744-9. [PubMed:10934208 ]
  5. Parvari R, Gonen Y, Alshafee I, Buriakovsky S, Regev K, Hershkovitz E: The 2p21 deletion syndrome: characterization of the transcription content. Genomics. 2005 Aug;86(2):195-211. [PubMed:15913950 ]