Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08799
Secondary Accession Numbers
  • 14522
Name Protein phosphatase 1L
Synonyms
  1. PP2C-epsilon
  2. Protein phosphatase 1-like
  3. Protein phosphatase 2C isoform epsilon
Gene Name PPM1L
Protein Type Unknown
Biological Properties
General Function Involved in catalytic activity
Specific Function Acts as a suppressor of the SAPK signaling pathways by associating with and dephosphorylating MAP3K7/TAK1 and MAP3K5, and by attenuating the association between MAP3K7/TAK1 and MAP2K4 or MAP2K6.
Pathways Not Available
Reactions
A phosphoprotein + Water → a protein + Phosphate details
GO Classification
Biological Process
small molecule metabolic process
phospholipid metabolic process
sphingolipid biosynthetic process
MAPK cascade
protein dephosphorylation
transmembrane receptor protein serine/threonine kinase signaling pathway
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Component
macromolecular complex
protein complex
protein serine/threonine phosphatase complex
Function
phosphoprotein phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
protein serine/threonine phosphatase activity
Molecular Function
protein serine/threonine phosphatase activity
metal ion binding
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein (Potential)
Gene Properties
Chromosome Location 3
Locus 3q26.1
SNPs PPM1L
Gene Sequence
>1083 bp
ATGATAGAGGATACAATGACTTTGCTGTCTCTGCTGGGTCGCATCATGCGCTACTTCTTG
CTGAGACCCGAGACGCTTTTCCTGCTGTGCATCAGCTTGGCTCTATGGAGTTACTTCTTC
CACACCGACGAGGTGAAGACCATCGTGAAGTCCAGCCGGGACGCCGTGAAGATGGTGAAG
GGCAAGGTAGCCGAGATCATGCAGAACGATCGACTCGGGGGGCTTGATGTGCTCGAGGCC
GAGTTTTCCAAGACCTGGGAGTTCAAGAACCACAACGTGGCGGTGTACTCCATCCAGGGC
CGGAGAGACCACATGGAGGACCGCTTCGAAGTTCTCACGGATCTGGCCAACAAGACGCAC
CCGTCCATCTTCGGGATCTTCGACGGGCACGGGGGAGAGACTGCAGCTGAATATGTAAAA
TCTCGACTCCCAGAGGCCCTTAAACAGCATCTTCAGGACTACGAGAAAGACAAAGAAAAT
AGTGTATTATCTTACCAGACCATCCTTGAACAGCAGATTTTGTCAATTGACCGAGAAATG
CTAGAAAAATTGACTGTATCCTATGATGAAGCAGGCACAACGTGTTTGATTGCTCTGCTA
TCAGATAAAGACCTCACTGTGGCCAACGTGGGTGACTCGCGCGGGGTCCTGTGTGACAAA
GATGGGAACGCTATTCCTTTGTCTCATGATCACAAGCCTTACCAGTTGAAGGAAAGAAAG
AGGATAAAGAGAGCAGGTGGTTTCATCAGTTTCAATGGCTCCTGGAGGGTCCAGGGAATC
CTGGCCATGTCTCGGTCCCTGGGGGATTATCCGCTGAAAAATCTCAACGTGGTCATCCCA
GACCCAGACATCCTGACCTTTGACCTGGACAAGCTTCAGCCTGAGTTCATGATCTTGGCA
TCAGATGGTCTCTGGGATGCTTTCAGCAATGAAGAAGCAGTTCGATTCATCAAGGAGCGC
TTGGATGAACCTCACTTTGGGGCCAAGAGCATAGTTTTACAGTCATTTTACAGAGGCTGC
CCTGACAATATAACAGTCATGGTGGTGAAGTTCAGAAATAGCAGCAAAACAGAAGAGCAG
TGA
Protein Properties
Number of Residues 360
Molecular Weight 41052.605
Theoretical pI 5.876
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Protein phosphatase 1L
MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVK
GKVAEIMQNDRLGGLDVLEAEFSKTWEFKNHNVAVYSIQGRRDHMEDRFEVLTDLANKTH
PSIFGIFDGHGGETAAEYVKSRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREM
LEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERK
RIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMILA
SDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSKTEEQ
GenBank ID Protein 63003905
UniProtKB/Swiss-Prot ID Q5SGD2
UniProtKB/Swiss-Prot Entry Name PPM1L_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_139245.2
GeneCard ID PPM1L
GenAtlas ID PPM1L
HGNC ID HGNC:16381
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Saito J, Toriumi S, Awano K, Ichijo H, Sasaki K, Kobayashi T, Tamura S: Regulation of apoptosis signal-regulating kinase 1 by protein phosphatase 2Cepsilon. Biochem J. 2007 Aug 1;405(3):591-6. [PubMed:17456047 ]
  4. Jin F, Ji C, Liu L, Dai J, Gu S, Sun X, Xie Y, Mao Y: Molecular cloning and characterization of a novel human protein phosphatase 2C cDNA (PP2C epsilon*). Mol Biol Rep. 2004 Sep;31(3):197-202. [PubMed:15560375 ]