You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08806
Secondary Accession Numbers
  • 14531
Name Rho-related GTP-binding protein RhoV
Synonyms
  1. CDC42-like GTPase 2
  2. GTP-binding protein-like 2
  3. Rho GTPase-like protein ARHV
  4. WRCH-2
  5. Wnt-1 responsive Cdc42 homolog 2
Gene Name RHOV
Protein Type Unknown
Biological Properties
General Function Involved in GTP binding
Specific Function Plays a role in the control of the actin cytoskeleton via activation of the JNK pathway
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
purine nucleotide binding
binding
nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signal transduction
small gtpase mediated signal transduction
Cellular Location
  1. Cell membrane
  2. Lipid-anchor
  3. Lipid-anchor
  4. Endosome membrane
  5. Cytoplasmic side
  6. Cytoplasmic side
Gene Properties
Chromosome Location Chromosome:1
Locus 15q13.3
SNPs RHOV
Gene Sequence
>711 bp
ATGCCGCCGCGGGAGCTGAGCGAGGCCGAGCCGCCCCCGCTCCGGGCCCCGACCCCTCCC
CCGCGGCGGCGTAGCGCGCCCCCAGAGCTGGGCATCAAGTGCGTGCTGGTGGGCGACGGC
GCCGTGGGCAAGAGCAGCCTCATCGTCAGCTACACCTGCAATGGGTACCCCGCGCGCTAC
CGGCCCACTGCGCTGGACACCTTCTCTGTGCAAGTCCTGGTGGATGGAGCTCCGGTGCGC
ATTGAGCTCTGGGACACAGCGGGACAGGAGGATTTTGACCGACTTCGTTCCCTTTGCTAC
CCGGATACCGATGTCTTCCTGGCGTGCTTCAGCGTGGTGCAGCCCAGCTCCTTTCAAAAC
ATCACAGAGAAATGGCTGCCCGAGATCCGCACGCACAACCCCCAGGCGCCTGTGCTGCTG
GTGGGCACCCAGGCCGACCTGAGGGACGATGTCAACGTACTAATTCAGCTGGACCAGGGG
GGCCGGGAGGGCCCCGTGCCCCAACCCCAGGCTCAGGGTCTGGCCGAGAGGATCCGAGCC
TGCTGCTACCTTGAGTGCTCAGCCTTGACGCAGAAGAACTTGAAGGAAGTATTTGACTCG
GCTATTCTCAGTGCCATTGAGCACAAAGCCCGGCTGGAGAAGAAACTGAATGCCAAAGGT
GTGCGCACCCTCTCCCGCTGCCGCTGGAAGAAGTTCTTCTGCTTCGTTTGA
Protein Properties
Number of Residues 236
Molecular Weight 26216.9
Theoretical pI 8.14
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Rho-related GTP-binding protein RhoV
MPPRELSEAEPPPLRAPTPPPRRRSAPPELGIKCVLVGDGAVGKSSLIVSYTCNGYPARY
RPTALDTFSVQVLVDGAPVRIELWDTAGQEDFDRLRSLCYPDTDVFLACFSVVQPSSFQN
ITEKWLPEIRTHNPQAPVLLVGTQADLRDDVNVLIQLDQGGREGPVPQPQAQGLAEKIRA
CCYLECSALTQKNLKEVFDSAILSAIEHKARLEKKLNAKGVRTLSRCRWKKFFCFV
GenBank ID Protein 19570848
UniProtKB/Swiss-Prot ID Q96L33
UniProtKB/Swiss-Prot Entry Name RHOV_HUMAN
PDB IDs Not Available
GenBank Gene ID AB079131
GeneCard ID RHOV
GenAtlas ID RHOV
HGNC ID HGNC:18313
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Katoh M: Molecular cloning and characterization of WRCH2 on human chromosome 15q15. Int J Oncol. 2002 May;20(5):977-82. [PubMed:11956592 ]
  3. Wherlock M, Mellor H: The Rho GTPase family: a Racs to Wrchs story. J Cell Sci. 2002 Jan 15;115(Pt 2):239-40. [PubMed:11839775 ]