Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08813
Secondary Accession Numbers
  • 14538
Name Serine/threonine-protein kinase SRPK1
Synonyms
  1. SFRS protein kinase 1
  2. SR-protein-specific kinase 1
  3. Serine/arginine-rich protein-specific kinase 1
Gene Name SRPK1
Protein Type Unknown
Biological Properties
General Function Involved in protein kinase activity
Specific Function Plays a central role in the regulatory network for splicing, controlling the intranuclear distribution of splicing factors in interphase cells and the reorganization of nuclear speckles during mitosis. Hyperphosphorylates RS domain-containing proteins such as SFRS1 and SFRS2 on serine residues during metaphase but at lower levels during interphase. Locks onto SFRS1 to form a stable complex and processively phosphorylates the RS domain. Appears to mediate HBV core protein phosphorylation which is a prerequisite for pregenomic RNA encapsidation into viral capsids
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:6
Locus 6p21.31
SNPs SRPK1
Gene Sequence
>1968 bp
ATGGAGCGGAAAGTGCTTGCGCTCCAGGCCCGAAAGAAAAGGACCAAGGCCAAGAAGGAC
AAAGCCCAAAGGAAATCTGAAACTCAGCACCGAGGCTCTGCTCCCCACTCTGAGAGTGAT
CTACCAGAGCAGGAAGAGGAGATTCTGGGATCTGATGATGATGAGCAAGAAGATCCTAAT
GATTATTGTAAAGGAGGTTATCATCTTGTGAAAATTGGAGATCTATTCAATGGGAGATAC
CATGTGATCCGAAAGTTAGGCTGGGGACACTTTTCAACAGTATGGTTATCATGGGATATT
CAGGGGAAGAAATTTGTGGCAATGAAAGTAGTTAAAAGTGCTGAACATTACACTGAAACA
GCACTAGATGAAATCCGGTTGCTGAAGTCAGTTCGCAATTCAGACCCTAATGATCCAAAT
AGAGAAATGGTTGTTCAACTACTAGATGACTTTAAAATATCAGGAGTTAATGGAACACAT
ATCTGCATGGTATTTGAAGTTTTGGGGCATCATCTGCTCAAGTGGATCATCAAATCCAAT
TATCAGGGGCTTCCACTGCCTTGTGTCAAAAAAATTATTCAGCAAGTGTTACAGGGTCTT
GATTATTTACATACCAAGTGCCGTATCATCCACACTGACATTAAACCAGAGAACATCTTA
TTGTCAGTGAATGAGCAGTACATTCGGAGGCTGGCTGCAGAAGCAACAGAATGGCAGCGA
TCTGGAGCTCCTCCGCCTTCCGGATCTGCAGTCAGTACTGCTCCCCAGCCTAAACCAGCT
GACAAAATGTCAAAGAATAAGAAGAAGAAATTGAAGAAGAAGCAGAAGCGCCAGGCAGAA
TTACTAGAGAAGCGAATGCAGGAAATTGAGGAAATGGAGAAAGAGTCGGGCCCTGGGCAA
AAAAGACCAAACAAGCAAGAAGAATCAGAGAGTCCTGTTGAAAGACCCTTGAAAGAGAAC
CCACCTAATAAAATGACCCAAGAAAAACTTGAAGAGTCAAGTACCATTGGCCAGGATCAA
ACGCTTATGGAACGTGATACAGAGGGTGGTGCAGCAGAAATTAATTGCAATGGAGTGATT
GAAGTCATTAATTATACTCAGAACAGTAATAATGAAACATTGAGACATAAAGAGGATCTA
CATAATGCTAATGACTGTGATGTCCAAAATTTGAATCAGGAATCTAGTTTCCTAAGCTCC
CAAAATGGAGACAGCAGCACATCTCAAGAAACAGACTCTTGTACACCTATAACATCTGAG
GTGTCAGACACCATGGTGTGCCAGTCTTCCTCAACTGTAGGTCAGTCATTCAGTGAACAA
CACATTAGCCAACTTCAAGAAAGCATTCGGGCAGAGATACCCTGTGAAGATGAACAAGAG
CAAGAACATAACGGACCACTGGACAACAAAGGAAAATCCACGGCTGGAAATTTTCTTGTT
AATCCCCTTGAGCCAAAAAATGCAGAAAAGCTCAAGGTGAAGATTGCTGACCTTGGAAAT
GCTTGTTGGGTGCACAAACATTTCACTGAAGATATTCAAACAAGGCAATATCGTTCCTTG
GAAGTTCTAATCGGATCTGGCTATAATACCCCTGCTGACATTTGGAGCACGGCATGCATG
GCCTTTGAACTGGCCACAGGTGACTATTTGTTTGAACCTCATTCAGGGGAAGAGTACACT
CGAGATGAAGATCACATTGCATTGATCATAGAACTTCTGGGGAAGGTGCCTCGCAAGCTC
ATTGTGGCAGGAAAATATTCCAAGGAATTTTTCACCAAAAAAGGTGACCTGAAACATATC
ACGAAGCTGAAACCTTGGGGCCTTTTTGAGGTTCTAGTGGAGAAGTATGAGTGGTCGCAG
GAAGAGGCAGCTGGCTTCACAGATTTCTTACTGCCCATGTTGGAGCTGATCCCTGAGAAG
AGAGCCACTGCCGCCGAGTGTCTCCGGCACCCTTGGCTTAACTCCTAA
Protein Properties
Number of Residues 655
Molecular Weight 74324.3
Theoretical pI 6.09
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase SRPK1
MERKVLALQARKKRTKAKKDKAQRKSETQHRGSAPHSESDLPEQEEEILGSDDDEQEDPN
DYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQGKKFVAMKVVKSAEHYTET
ALDEIRLLKSVRNSDPNDPNREMVVQLLDDFKISGVNGTHICMVFEVLGHHLLKWIIKSN
YQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILLSVNEQYIRRLAAEATEWQR
SGAPPPSGSAVSTAPQPKPADKMSKNKKKKLKKKQKRQAELLEKRMQEIEEMEKESGPGQ
KRPNKQEESESPVERPLKENPPNKMTQEKLEESSTIGQDQTLMERDTEGGAAEINCNGVI
EVINYTQNSNNETLRHKEDLHNANDCDVQNLNQESSFLSSQNGDSSTSQETDSCTPITSE
VSDTMVCQSSSTVGQSFSEQHISQLQESIRAEIPCEDEQEQEHNGPLDNKGKSTAGNFLV
NPLEPKNAEKLKVKIADLGNACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWSTACM
AFELATGDYLFEPHSGEEYTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKHI
TKLKPWGLFEVLVEKYEWSQEEAAGFTDFLLPMLELIPEKRATAAECLRHPWLNS
GenBank ID Protein 47419936
UniProtKB/Swiss-Prot ID Q96SB4
UniProtKB/Swiss-Prot Entry Name SRPK1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_003137.4
GeneCard ID SRPK1
GenAtlas ID SRPK1
HGNC ID HGNC:11305
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  6. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  7. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  8. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  9. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  10. Gui JF, Lane WS, Fu XD: A serine kinase regulates intracellular localization of splicing factors in the cell cycle. Nature. 1994 Jun 23;369(6482):678-82. [PubMed:8208298 ]
  11. Nikolakaki E, Kohen R, Hartmann AM, Stamm S, Georgatsou E, Giannakouros T: Cloning and characterization of an alternatively spliced form of SR protein kinase 1 that interacts specifically with scaffold attachment factor-B. J Biol Chem. 2001 Oct 26;276(43):40175-82. Epub 2001 Aug 16. [PubMed:11509566 ]
  12. Daub H, Blencke S, Habenberger P, Kurtenbach A, Dennenmoser J, Wissing J, Ullrich A, Cotten M: Identification of SRPK1 and SRPK2 as the major cellular protein kinases phosphorylating hepatitis B virus core protein. J Virol. 2002 Aug;76(16):8124-37. [PubMed:12134018 ]
  13. Lee CG, Hague LK, Li H, Donnelly R: Identification of toposome, a novel multisubunit complex containing topoisomerase IIalpha. Cell Cycle. 2004 May;3(5):638-47. Epub 2004 May 4. [PubMed:15034300 ]
  14. Aubol BE, Chakrabarti S, Ngo J, Shaffer J, Nolen B, Fu XD, Ghosh G, Adams JA: Processive phosphorylation of alternative splicing factor/splicing factor 2. Proc Natl Acad Sci U S A. 2003 Oct 28;100(22):12601-6. Epub 2003 Oct 10. [PubMed:14555757 ]
  15. Mylonis I, Giannakouros T: Protein kinase CK2 phosphorylates and activates the SR protein-specific kinase 1. Biochem Biophys Res Commun. 2003 Feb 14;301(3):650-6. [PubMed:12565829 ]
  16. Souki SK, Sandri-Goldin RM: Arginine methylation of the ICP27 RGG box regulates the functional interactions of ICP27 with SRPK1 and Aly/REF during herpes simplex virus 1 infection. J Virol. 2009 Sep;83(17):8970-5. doi: 10.1128/JVI.00801-09. Epub 2009 Jun 24. [PubMed:19553338 ]
  17. Ngo JC, Chakrabarti S, Ding JH, Velazquez-Dones A, Nolen B, Aubol BE, Adams JA, Fu XD, Ghosh G: Interplay between SRPK and Clk/Sty kinases in phosphorylation of the splicing factor ASF/SF2 is regulated by a docking motif in ASF/SF2. Mol Cell. 2005 Oct 7;20(1):77-89. [PubMed:16209947 ]