Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08814
Secondary Accession Numbers
  • 14539
Name Serine/threonine-protein kinase SRPK2
Synonyms
  1. SFRS protein kinase 2
  2. SR-protein-specific kinase 2
  3. Serine/arginine-rich protein-specific kinase 2
Gene Name SRPK2
Protein Type Unknown
Biological Properties
General Function Involved in protein kinase activity
Specific Function Phosphorylates RS domain-containing proteins, such as SFRS1 and SFRS2 on serine residues. Role in spliceosome assembly and in mediating the trafficking of splicing factors. Appears to mediate HBV core protein phosphorylation which is a prerequisite for pregenomic RNA encapsidation into viral capsids
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:7
Locus 7q22-q31.1
SNPs SRPK2
Gene Sequence
>2067 bp
ATGTCAGTTAACTCTGAGAAGTCGTCCTCTTCAGAAAGGCCGGAGCCTCAACAGAAAGCT
CCTTTAGTTCCTCCTCCTCCACCGCCACCACCACCACCACCGCCACCTTTGCCAGACCCC
ACACCCCCGGAGCCAGAGGAGGAGATCCTGGGATCAGATGATGAGGAGCAAGAGGACCCT
GCGGACTACTGCAAAGGTGGATATCATCCAGTGAAAATTGGAGACCTCTTCAATGGCCGG
TATCATGTTATTAGAAAGCTTGGATGGGGGCACTTCTCTACTGTCTGGCTGTGCTGGGAT
ATGCAGGGGAAAAGATTTGTTGCAATGAAAGTTGTAAAAAGTGCCCAGCATTATACGGAG
ACAGCCTTGGATGAAATAAAATTGCTCAAATGTGTTCGAGAAAGTGATCCCAGTGACCCA
AACAAAGACATGGTGGTCCAGCTCATTGACGACTTCAAGATTTCAGGCATGAATGGGATA
CATGTCTGCATGGTCTTCGAAGTACTTGGCCACCATCTCCTCAAGTGGATCATCAAATCC
AACTATCAAGGCCTCCCAGTACGTTGTGTGAAGAGTATCATTCGACAGGTCCTTCAAGGG
TTAGATTACTTACACAGTAAGTGCAAGATCATTCATACTGACATAAAGCCGGAAAATATC
TTGATGTGTGTGGATGATGCATATGTGAGAAGAATGGCAGCTGAGGCCACTGAGTGGCAG
AAAGCAGGTGCTCCTCCTCCTTCAGGGTCTGCAGTGAGTACGGCTCCACAGCAGAAACCT
ATAGGAAAAATATCTAAAAACAAAAAGAAAAAACTGAAAAAGAAACAGAAGAGGCAGGCT
GAGTTATTGGAGAAGCGCCTGCAGGAGATAGAAGAATTGGAGCGAGAAGCTGAAAGGAAA
ATAATAGAAGAAAACATCACCTCAGCTGCACCTTCCAATGACCAGGATGGCGAATACTGC
CCAGAGGTGAAACTAAAAACAACAGGATTAGAGGAGGCGGCTGAGGCAGAGACTGCAAAG
GACAATGGTGAAGCTGAGGACCAGGAAGAGAAAGAAGATGCTGAGAAAGAAAACATTGAA
AAAGATGAAGATGATGTAGATCAGGAACTTGCGAACATAGACCCTACGTGGATAGAATCA
CCTAAAACCAATGGCCATATTGAGAATGGCCCATTCTCACTGGAGCAGCAACTGGACGAT
GAAGATGATGATGAAGAAGACTGCCCAAATCCTGAGGAATATAATCTTGATGAGCCAAAT
GCAGAAAGTGATTACACATATAGCAGCTCCTATGAACAATTCAATGGTGAATTGCCAAAT
GGACGACATAAAATTCCCGAGTCACAGTTCCCAGAGTTTTCCACCTCGTTGTTCTCTGGA
TCCTTAGAACCTGTGGCCTGCGGCTCTGTGCTTTCTGAGGGATCACCACTTACTGAGCAA
GAGGAGAGCAGTCCATCCCATGACAGAAGCAGAACGGTTTCAGCCTCCAGTACTGGGGAT
TTGCCAAAAGCAAAAACCCGGGCAGCTGACTTGTTGGTGAATCCCCTGGATCCGCGGAAT
GCAGATAAAATTAGAGTAAAAATTGCTGACCTGGGAAATGCTTGTTGGGTGCATAAACAC
TTCACGGAAGACATCCAGACGCGTCAGTACCGCTCCATAGAGGTTTTAATAGGAGCGGGG
TACAGCACCCCTGCGGACATCTGGAGCACGGCGTGTATGGCATTTGAGCTGGCAACGGGA
GATTATTTGTTTGAACCACATTCTGGGGAAGACTATTCCAGAGACGAAGACCACATAGCC
CACATCATAGAGCTGCTAGGCAGTATTCCAAGGCACTTTGCTCTATCTGGAAAATATTCT
CGGGAATTCTTCAATCGCAGAGGAGAACTGCGACACATCACCAAGCTGAAGCCCTGGAGC
CTCTTTGATGTACTTGTGGAAAAGTATGGCTGGCCCCATGAAGATGCTGCACAGTTTACA
GATTTCCTGATCCCGATGTTAGAAATGGTTCCAGAAAAACGAGCCTCAGCTGGCGAATGC
CTTCGGCATCCTTGGTTGAATTCTTAG
Protein Properties
Number of Residues 688
Molecular Weight 77526.0
Theoretical pI 4.61
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Serine/threonine-protein kinase SRPK2
MSVNSEKSSSSERPEPQQKAPLVPPPPPPPPPPPPPLPDPTPPEPEEEILGSDDEEQEDP
ADYCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVVKSAQHYTE
TALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEVLGHHLLKWIIKS
NYQGLPVRCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAYVRRMAAEATEWQ
KAGAPPPSGSAVSTAPQQKPIGKISKNKKKKLKKKQKRQAELLEKRLQEIEELEREAERK
IIEENITSAAPSNDQDGEYCPEVKLKTTGLEEAAEAETAKDNGEAEDQEEKEDAEKENIE
KDEDDVDQELANIDPTWIESPKTNGHIENGPFSLEQQLDDEDDDEEDCPNPEEYNLDEPN
AESDYTYSSSYEQFNGELPNGRHKIPESQFPEFSTSLFSGSLEPVACGSVLSEGSPLTEQ
EESSPSHDRSRTVSASSTGDLPKAKTRAADLLVNPLDPRNADKIRVKIADLGNACWVHKH
FTEDIQTRQYRSIEVLIGAGYSTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIA
HIIELLGSIPRHFALSGKYSREFFNRRGELRHITKLKPWSLFDVLVEKYGWPHEDAAQFT
DFLIPMLEMVPEKRASAGECLRHPWLNS
GenBank ID Protein 33188447
UniProtKB/Swiss-Prot ID P78362
UniProtKB/Swiss-Prot Entry Name SRPK2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_182691.1
GeneCard ID SRPK2
GenAtlas ID SRPK2
HGNC ID HGNC:11306
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ: Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12. [PubMed:15592455 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  7. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]
  8. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  9. Daub H, Blencke S, Habenberger P, Kurtenbach A, Dennenmoser J, Wissing J, Ullrich A, Cotten M: Identification of SRPK1 and SRPK2 as the major cellular protein kinases phosphorylating hepatitis B virus core protein. J Virol. 2002 Aug;76(16):8124-37. [PubMed:12134018 ]
  10. Wang HY, Lin W, Dyck JA, Yeakley JM, Songyang Z, Cantley LC, Fu XD: SRPK2: a differentially expressed SR protein-specific kinase involved in mediating the interaction and localization of pre-mRNA splicing factors in mammalian cells. J Cell Biol. 1998 Feb 23;140(4):737-50. [PubMed:9472028 ]