You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08824
Secondary Accession Numbers
  • 14549
Name 3'-5' exoribonuclease 1
Synonyms
  1. 3'-5' exonuclease ERI1
  2. Eri-1 homolog
  3. HEXO
  4. Histone mRNA 3'-end-specific exoribonuclease
  5. Histone mRNA 3'-exonuclease 1
  6. Protein 3'hExo
Gene Name ERI1
Protein Type Unknown
Biological Properties
General Function Involved in exonuclease activity
Specific Function RNA exonuclease that binds to the 3'-end of histone mRNAs and degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. A 2' and 3'-hydroxyl groups at the last nucleotide of the histone 3'-end is required for efficient degradation of RNA substrates. Also able to degrade the 3'-overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as regulator of RNA interference (RNAi). Requires for binding the 5'-ACCCA-3' sequence present in stem-loop structure. Able to bind other mRNAs. Required for 5.8S rRNA 3'-end processing. Also binds to 5.8s ribosomal RNA. Binds with high affinity to the stem-loop structure of replication- dependent histone pre-mRNAs
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
exonuclease activity
nucleic acid binding
nuclease activity
Cellular Location
  1. Nucleus
  2. Nucleus
  3. Cytoplasm
  4. nucleolus
Gene Properties
Chromosome Location Chromosome:8
Locus 8p23.1
SNPs ERI1
Gene Sequence
>1050 bp
ATGGAGGATCCACAGAGTAAAGAGCCTGCCGGCGAGGCCGTGGCTCTCGCGCTGCTGGAG
TCGCCGCGGCCGGAGGGCGGGGAGGAGCCGCCGCGTCCCAGTCCCGAGGAAACTCAACAG
TGTAAATTTGATGGCCAGGAGACAAAAGGATCCAAGTTCATTACCTCCAGTGCGAGTGAC
TTCAGTGACCCGGTTTACAAAGAGATTGCCATTACGAATGGCTGTATTAATAGAATGAGT
AAGGAAGAACTCAGAGCTAAGCTTTCAGAATTCAAGCTTGAAACTAGAGGAGTAAAGGAT
GTTCTAAAGAAGAGACTGAAAAACTATTATAAGAAGCAGAAGCTGATGCTGAAAGAGAGC
AATTTTGCTGACAGTTATTATGACTACATTTGTATTATTGACTTTGAAGCCACTTGTGAA
GAAGGAAACCCACCTGAGTTTGTACATGAAATAATTGAATTTCCGGTTGTTTTACTGAAT
ACGCATACTTTAGAAATAGAAGACACGTTTCAGCAGTATGTAAGACCAGAGATTAACACA
CAGCTGTCTGATTTCTGCATCAGTCTAACTGGAATTACTCAGGATCAGGTAGACAGAGCT
GATACCTTCCCTCAGGTACTAAAAAAAGTAATTGACTGGATGAAATTGAAGGAATTAGGA
ACAAAGTATAAATACTCACTTTTAACAGATGGTTCTTGGGATATGAGTAAGTTCTTGAAC
ATTCAGTGTCAACTCAGCAGGCTCAAATACCCTCCTTTTGCGAAAAAGTGGATCAATATT
CGGAAGTCATATGGAAATTTTTACAAGGTTCCTAGAAGCCAAACCAAACTGACAATAATG
CTTGAAAAATTAGGAATGGATTATGATGGGCGGCCTCACTGTGGTCTTGATGACTCTAAG
AATATCGCCCGAATAGCAGTTCGAATGCTTCAGGATGGGTGTGAACTCCGAATCAACGAG
AAAATGCATGCAGGACAGCTAATGAGTGTGTCCTCTTCCTTACCAATAGAGGGCACTCCA
CCACCACAAATGCCACATTTTAGAAAGTAA
Protein Properties
Number of Residues 349
Molecular Weight 40063.6
Theoretical pI 6.67
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>3'-5' exoribonuclease 1
MEDPQSKEPAGEAVALALLESPRPEGGEEPPRPSPEETQQCKFDGQETKGSKFITSSASD
FSDPVYKEIAITNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKES
NFADSYYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINT
QLSDFCISLTGITQDQVDRADTFPQVLKKVIDWMKLKELGTKYKYSLLTDGSWDMSKFLN
IQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPHCGLDDSK
NIARIAVRMLQDGCELRINEKMHAGQLMSVSSSLPIEGTPPPQMPHFRK
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8IV48
UniProtKB/Swiss-Prot Entry Name ERI1_HUMAN
PDB IDs
GenBank Gene ID AY310909
GeneCard ID ERI1
GenAtlas ID ERI1
HGNC ID HGNC:23994
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Dominski Z, Yang XC, Kaygun H, Dadlez M, Marzluff WF: A 3' exonuclease that specifically interacts with the 3' end of histone mRNA. Mol Cell. 2003 Aug;12(2):295-305. [PubMed:14536070 ]
  6. Kennedy S, Wang D, Ruvkun G: A conserved siRNA-degrading RNase negatively regulates RNA interference in C. elegans. Nature. 2004 Feb 12;427(6975):645-9. [PubMed:14961122 ]
  7. Yang XC, Purdy M, Marzluff WF, Dominski Z: Characterization of 3'hExo, a 3' exonuclease specifically interacting with the 3' end of histone mRNA. J Biol Chem. 2006 Oct 13;281(41):30447-54. Epub 2006 Aug 15. [PubMed:16912046 ]
  8. Cheng Y, Patel DJ: Crystallographic structure of the nuclease domain of 3'hExo, a DEDDh family member, bound to rAMP. J Mol Biol. 2004 Oct 15;343(2):305-12. [PubMed:15451662 ]