Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08829
Secondary Accession Numbers
  • 14554
Name CCA tRNA nucleotidyltransferase 1, mitochondrial
Synonyms
  1. Mitochondrial tRNA nucleotidyl transferase, CCA-adding
  2. mt CCA-adding enzyme
  3. mt tRNA CCA-diphosphorylase
  4. mt tRNA CCA-pyrophosphorylase
  5. mt tRNA adenylyltransferase
Gene Name TRNT1
Protein Type Unknown
Biological Properties
General Function Involved in RNA binding
Specific Function Isoform 1: Adds and repairs the conserved 3'-CCA sequence necessary for the attachment of amino acids to the 3' terminus of tRNA molecules, using CTP and ATP as substrates. Isoform 2: Adds 2 C residues (CC-) to the 3' terminus of tRNA molecules instead of a complete CCA end as isoform 1 does (in vitro).
Pathways
  • Nucleocytoplasmic transport
Reactions
A tRNA precursor + Cytidine triphosphate + Adenosine triphosphate → a tRNA with a 3' CCA end + Pyrophosphate details
tRNA precursor + Cytidine triphosphate + Adenosine triphosphate → tRNA with a 3' CCA end + Pyrophosphate details
tRNA precursor + Cytidine triphosphate → tRNA with a 3' cytidine + Pyrophosphate details
tRNA with a 3' cytidine + Cytidine triphosphate → tRNA with a 3' CC end + Pyrophosphate details
tRNA with a 3' CC end + Adenosine triphosphate → tRNA with a 3' CCA end + Pyrophosphate details
GO Classification
Biological Process
tRNA 3'-end processing
tRNA 3'-terminal CCA addition
protein targeting to mitochondrion
Cellular Component
centrosome
mitochondrion
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
nucleotidyltransferase activity
nucleic acid binding
rna binding
Molecular Function
ATP:3'-cytidine-cytidine-tRNA adenylyltransferase activity
CTP:3'-cytidine-tRNA cytidylyltransferase activity
CTP:tRNA cytidylyltransferase activity
tRNA adenylyltransferase activity
tRNA nucleotidyltransferase activity
ATP binding
tRNA binding
Process
rna metabolic process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
rna processing
Cellular Location
  1. Mitochondrion
Gene Properties
Chromosome Location 3
Locus 3p25.1
SNPs TRNT1
Gene Sequence
>1305 bp
ATGCTGAGGTGCCTGTATCATTGGCACAGGCCAGTGCTGAACCGTAGGTGGAGTAGGCTG
TGCCTTCTGAAGCAGTATCTATTCACAATGAAGTTGCAGTCTCCCGAATTCCAGTCACTT
TTCACAGAAGGACTGAAGAGTCTGACAGAATTATTTGTCAAAGAGAATCACGAATTAAGA
ATAGCAGGAGGAGCAGTGAGGGATTTATTAAATGGAGTAAAGCCTCAGGATATAGATTTT
GCCACCACTGCTACCCCTACTCAAATGAAGGAGATGTTTCAGTCGGCTGGGATTCGGATG
ATAAACAACAGAGGAGAAAAGCACGGAACAATTACTGCCAGGCTTCATGAAGAAAATTTT
GAGATTACTACACTACGGATTGATGTCACCACTGATGGAAGACATGCTGAGGTAGAATTT
ACAACTGACTGGCAGAAAGATGCGGAACGCAGAGATCTCACTATAAATTCTATGTTTTTA
GGTTTTGATGGCACTTTATTTGACTACTTTAATGGTTATGAAGATTTAAAAAATAAGAAA
GTTAGATTTGTTGGACATGCTAAACAGAGAATACAAGAGGATTATCTTAGAATTTTAAGA
TACTTCAGGTTTTATGGGAGAATTGTAGACAAACCTGGTGACCATGATCCTGAGACTTTG
GAAGCAATTGCAGAAAATGCAAAAGGCTTGGCTGGAATATCAGGAGAAAGGATTTGGGTG
GAACTGAAAAAAATTCTTGTTGGTAACCATGTAAATCATTTGATTCACCTTATCTATGAT
CTTGATGTGGCTCCTTATATAGGTTTACCTGCTAATGCAAGTTTAGAAGAATTTGACAAA
GTCAGTAAAAATGTTGATGGTTTTTCACCAAAGCCAGTGACTCTTTTGGCCTCATTATTC
AAAGTACAAGATGATGTCACAAAATTGGATTTGAGGTTGAAGATCGCGAAAGAGGAGAAA
AACCTTGGCTTATTTATAGTTAAAAATAGGAAAGATTTAATTAAAGCAACAGATAGTTCA
GACCCATTGAAACCCTATCAAGACTTCATTATAGATTCTAGGGAACCTGATGCAACTACT
CGTGTATGTGAACTACTGAAGTACCAAGGAGAGCACTGTCTCCTAAAGGAAATGCAGCAG
TGGTCCATTCCTCCATTTCCTGTAAGTGGCCATGACATCAGAAAAGTGGGCATTTCTTCA
GGAAAAGAAATTGGGGCTCTATTACAACAGTTGCGAGAACAGTGGAAAAAAAGTGGTTAC
CAAATGGAAAAAGATGAACTTCTGAGTTACATAAAGAAGACCTAA
Protein Properties
Number of Residues 434
Molecular Weight 50143.185
Theoretical pI 8.102
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>tRNA-nucleotidyltransferase 1, mitochondrial
MLRCLYHWHRPVLNRRWSRLCLPKQYLFTMKLQSPEFQSLFTEGLKSLTELFVKENHELR
IAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENF
EITTLRIDVTTDGRHAEVEFTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKK
VRFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIWV
ELKKILVGNHVNHLIHLIYDLDVAPYIGLPANASLEEFDKVSKNVDGFSPKPVTLLASLF
KVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATT
RVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIRKVGISSGKEIGALLQQLREQWKKSGY
QMEKDELLSYIKKT
GenBank ID Protein 16416451
UniProtKB/Swiss-Prot ID Q96Q11
UniProtKB/Swiss-Prot Entry Name TRNT1_HUMAN
PDB IDs
GenBank Gene ID AB063105
GeneCard ID TRNT1
GenAtlas ID TRNT1
HGNC ID HGNC:17341
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997 ]
  6. Lai CH, Chou CY, Ch'ang LY, Liu CS, Lin W: Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics. Genome Res. 2000 May;10(5):703-13. [PubMed:10810093 ]
  7. Simpson JC, Wellenreuther R, Poustka A, Pepperkok R, Wiemann S: Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing. EMBO Rep. 2000 Sep;1(3):287-92. [PubMed:11256614 ]
  8. Nagaike T, Suzuki T, Tomari Y, Takemoto-Hori C, Negayama F, Watanabe K, Ueda T: Identification and characterization of mammalian mitochondrial tRNA nucleotidyltransferases. J Biol Chem. 2001 Oct 26;276(43):40041-9. Epub 2001 Aug 14. [PubMed:11504732 ]
  9. Augustin MA, Reichert AS, Betat H, Huber R, Morl M, Steegborn C: Crystal structure of the human CCA-adding enzyme: insights into template-independent polymerization. J Mol Biol. 2003 May 16;328(5):985-94. [PubMed:12729736 ]