You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08851
Secondary Accession Numbers
  • 14578
Name Phosphoinositide 3-kinase regulatory subunit 4
Synonyms
  1. PI3-kinase p150 subunit
  2. PI3-kinase regulatory subunit 4
  3. Phosphoinositide 3-kinase adaptor protein
Gene Name PIK3R4
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Regulatory subunit of the PI3K complex. May regulate membrane trafficking late in the endocytic pathway
Pathways
  • Inositol Metabolism
  • Joubert syndrome
  • Phosphatidylinositol Phosphate Metabolism
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:3
Locus 3q22.1
SNPs PIK3R4
Gene Sequence
>4077 bp
ATGGGAAATCAGCTTGCTGGCATTGCTCCCTCCCAGATCCTTTCTGTAGAGAGTTATTTT
TCAGATATTCATGACTTTGAATATGATAAAAGCCTGGGGAGTACTCGGTTTTTTAAAGTT
GCTCGAGCCAAGCACCGAGAAGGCCTGGTCGTTGTGAAGGTTTTTGCAATTCAGGATCCC
ACATTGCCTTTAACCAGCTATAAACAAGAGCTGGAGGAACTGAAAATCAGGCTTAATTCT
GCACAGAATTGTCTACCTTTCCAGAAAGCATCAGAAAAAGCATCTGAGAAAGCAGCTATG
CTCTTTAGGCAGTATGTGCGAGACAATCTCTATGATCGCATCAGTACCCGTCCATTCTTG
AATAACATTGAGAAGCGCTGGATTGCTTTCCAGATCCTGACAGCTGTGGACCAAGCACAC
AAATCTGGAGTTCGTCATGGGGACATCAAGACTGAGAATGTGATGGTCACCAGTTGGAAT
TGGGTTCTTCTAACTGATTTTGCCAGTTTTAAGCCCACTTATCTTCCAGAAGACAACCCG
GCAGATTTCAATTATTTCTTTGACACATCACGGAGGAGAACTTGCTATATTGCTCCTGAA
CGTTTTGTTGATGGTGGGATGTTTGCCACTGAGTTAGAATATATGAGAGATCCTTCAACT
CCGCTTGTAGACTTAAATAGCAATCAGAGAACAAGAGGAGAGTTGAAGAGAGCAATGGAC
ATCTTTTCAGCAGGTTGTGTGATAGCTGAGCTTTTTACAGAAGGTGTACCATTATTTGAT
CTCTCTCAACTTTTGGCTTATAGAAATGGACATTTTTTCCCTGAACAAGTGCTAAATAAA
ATTGAAGATCACAGTATCAGAGAATTGGTAACTCAGATGATTCACCGTGAGCCAGATAAA
CGTTTAGAGGCAGAAGATTACTTAAAACAGCAGCGTGGCAATGCCTTTCCTGAAATATTT
TACACTTTTCTTCAGCCCTACATGGCCCAGTTTGCCAAGGAAACGTTTCTTTCTGCAGAT
GAGCGTATTCTGGTTATACGGAAGGATTTGGGCAACATTATTCACAATCTCTGTGGACAT
GATCTGCCAGAAAAAGCCGAAGGAGAGCCTAAGGAAAATGGGCTGGTTATCTTGGTATCT
GTTATAACATCCTGCCTACAGACCCTTAAATACTGTGATTCCAAACTAGCTGCTTTGGAA
CTGATTCTTCATTTGGCTCCAAGATTAAGTGTTGAAATCCTTTTGGATCGTATTACTCCA
TATCTTTTGCATTTCAGCAATGACTCTGTTCCTAGGGTGAGGGCTGAAGCCTTGAGGACG
TTGACCAAAGTTCTTGCTCTCGTCAAAGAGGTTCCTCGTAATGATATCAATATTTATCCG
GAATACATTCTGCCAGGCATAGCCCACTTAGCCCAAGATGATGCTACTATCGTTAGACTA
GCCTATGCTGAAAACATAGCTCTGCTGGCAGAAACAGCTCTGAGATTCCTGGAATTAGTA
CAGTTAAAAAATCTTAATATGGAAAATGACCCCAATAATGAAGAAATAGATGAGGTTACA
CATCCAAATGGAAATTATGACACAGAGCTCCAAGCCTTACATGAAATGGTCCAGCAGAAA
GTTGTTACTTTGCTAAGTGACCCTGAAAATATTGTAAAACAAACCTTGATGGAAAATGGA
ATAACACGGCTGTGTGTATTCTTTGGACGTCAGAAAGCCAACGATGTTTTGTTGTCCCAC
ATGATTACTTTCCTAAATGATAAGAATGATTGGCATCTACGTGGAGCATTTTTTGATAGT
ATAGTTGGTGTTGCTGCCTATGTTGGCTGGCAAAGCTCCTCAATTCTCAAGCCTCTGCTG
CAACAAGGTCTTAGTGATGCTGAGGAATTTGTCATTGTGAAAGCTCTTTATGCCCTTACT
TGTATGTGCCAGTTAGGACTGCTACAAAAACCCCATGTTTACGAATTTGCCAGTGATATT
GCCCCCTTCCTGTGTCATCCCAATTTATGGATACGTTATGGTGCCGTGGGATTTATCACA
GTGGTAGCTCGTCAAATAAGTACAGCTGATGTCTACTGTAAACTGATGCCTTATCTTGAC
CCATATATTACCCAACCAATAATACAGATTGAAAGAAAACTTGTTCTGCTCAGTGTTTTA
AAGGAACCAGTAAGTCGTTCTATATTTGATTATGCTTTGAGGTCTAAAGATATTACTAGC
TTGTTCAGACATCTTCACATGCGTCAGAAGAAACGAAATGGTTCTCTTCCCGACTGCCCT
CCGCCAGAGGATCCTGCCATAGCACAGCTTCTGAAGAAGTTGCTCTCACAGGGAATGACA
GAGGAAGAGGAAGACAAACTTCTGGCACTGAAAGACTTCATGATGAAATCTAATAAAGCA
AAGGCCAATATAGTGGACCAGAGCCATCTTCATGATAGTAGTCAGAAAGGTGTAATTGAC
TTGGCAGCTTTAGGCATAACTGGGAGACAAGTTGATCTTGTTAAAACCAAACAAGAACCA
GATGACAAACGGGCCAGAAAACATGTAAAACAAGACTCAAATGTAAATGAAGAATGGAAA
AGCATGTTTGGGTCACTGGACCCACCAAACATGCCACAGGCCCTACCTAAAGGGAGTGAT
CAGGAGGTGATTCAGACTGGGAAACCTCCTCGTTCCGAGTCCTCTGCTGGCATTTGTGTC
CCTTTGTCAACTTCTTCACAGGTTCCAGAAGTGACAACTGTCCAAAATAAAAAACCAGTA
ATACCGGTTTTAAGTAGTACAATCTTACCATCCACCTATCAGATTCGAATTACAACTTGT
AAAACTGAACTTCAGCAACTCATCCAGCAAAAGCGGGAGCAGTGCAATGCTGAGAGAATA
GCTAAGCAGATGATGGAAAATGCTGAATGGGAGAGTAAACCACCACCACCTGGATGGCGT
CCTAAAGGGCTGTTAGTTGCCCATCTTCATGAGCATAAATCTGCTGTGAATCGAATTAGA
GTCTCTGATGAACACTCACTTTTTGCAACATGTTCAAATGATGGCACAGTGAAAATCTGG
AACAGTCAAAAGATGGAGGGGAAGACCACCACTACCAGATCTATTCTTACATACAGCCGA
ATTGGAGGACGAGTCAAGACGCTCACATTCTGCCAAGGCTCCCACTATTTAGCCATAGCA
TCTGATAATGGTGCTGTCCAGCTTCTTGGAATTGAGGCTTCTAAGCTGCCCAAGTCTCCT
AAAATCCATCCTCTACAAAGCAGAATTCTAGATCAGAAGGAGGACGGTTGTGTTGTGGAT
ATGCATCACTTCAACTCTGGAGCACAGTCTGTTCTTGCCTATGCCACTGTGAATGGCTCT
CTGGTTGGCTGGGACCTTAGGTCTTCAAGCAATGCGTGGACTTTAAAGCATGATTTAAAG
TCGGGCCTCATCACTTCCTTTGCTGTGGACATCCACCAATGCTGGCTCTGCATTGGTACA
AGCAGTGGTACCATGGCTTGTTGGGACATGAGGTTCCAGTTGCCAATTTCAAGTCACTGT
CATCCTTCCAGGGCTCGAATCAGACGCCTCTCAATGCACCCTCTGTATCAGTCCTGGGTG
ATTGCAGCTGTTCAGGGCAACAACGAAGTGTCCATGTGGGACATGGAGACTGGTGACAGA
AGATTTACTCTCTGGGCCAGCAGTGCACCACCACTTTCTGAATTACAGCCTTCTCCTCAT
AGCGTCCATGGTATCTACTGTAGTCCTGCAGATGGAAATCCTATCCTACTAACAGCTGGC
TCAGATATGAAAATAAGGTTTTGGGACTTGGCTTACCCAGAAAGGTCCTATGTTGTTGCA
GGAAGTACTAGTTCCCCATCTGTGTCCTACTACAGGAAAATAATTGAAGGCACTGAAGTT
GTCCAGGAAATTCAGAATAAGCAGAAAGTAGGACCAAGTGATGACACCCCTCGAAGGGGC
CCAGAGTCCCTGCCCGTGGGACATCATGACATCATCACTGATGTCGCCACATTCCAGACC
ACACAGGGCTTCATCGTAACTGCTTCTAGAGATGGGATTGTGAAGGTGTGGAAATAA
Protein Properties
Number of Residues 1358
Molecular Weight 153102.1
Theoretical pI 7.17
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Phosphoinositide 3-kinase regulatory subunit 4
MGNQLAGIAPSQILSVESYFSDIHDFEYDKSLGSTRFFKVARAKHREGLVVVKVFAIQDP
TLPLTSYKQELEELKIRLNSAQNCLPFQKASEKASEKAAMLFRQYVRDNLYDRISTRPFL
NNIEKRWIAFQILTAVDQAHKSGVRHGDIKTENVMVTSWNWVLLTDFASFKPTYLPEDNP
ADFNYFFDTSRRRTCYIAPERFVDGGMFATELEYMRDPSTPLVDLNSNQRTRGELKRAMD
IFSAGCVIAELFTEGVPLFDLSQLLAYRNGHFFPEQVLNKIEDHSIRELVTQMIHREPDK
RLEAEDYLKQQRGNAFPEIFYTFLQPYMAQFAKETFLSADERILVIRKDLGNIIHNLCGH
DLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRLSVEILLDRITP
YLLHFSNDSVPRVRAEALRTLTKVLALVKEVPRNDINIYPEYILPGIAHLAQDDATIVRL
AYAENIALLAETALRFLELVQLKNLNMENDPNNEEIDEVTHPNGNYDTELQALHEMVQQK
VVTLLSDPENIVKQTLMENGITRLCVFFGRQKANDVLLSHMITFLNDKNDWHLRGAFFDS
IVGVAAYVGWQSSSILKPLLQQGLSDAEEFVIVKALYALTCMCQLGLLQKPHVYEFASDI
APFLCHPNLWIRYGAVGFITVVARQISTADVYCKLMPYLDPYITQPIIQIERKLVLLSVL
KEPVSRSIFDYALRSKDITSLFRHLHMRQKKRNGSLPDCPPPEDPAIAQLLKKLLSQGMT
EEEEDKLLALKDFMMKSNKAKANIVDQSHLHDSSQKGVIDLAALGITGRQVDLVKTKQEP
DDKRARKHVKQDSNVNEEWKSMFGSLDPPNMPQALPKGSDQEVIQTGKPPRSESSAGICV
PLSTSSQVPEVTTVQNKKPVIPVLSSTILPSTYQIRITTCKTELQQLIQQKREQCNAERI
AKQMMENAEWESKPPPPGWRPKGLLVAHLHEHKSAVNRIRVSDEHSLFATCSNDGTVKIW
NSQKMEGKTTTTRSILTYSRIGGRVKTLTFCQGSHYLAIASDNGAVQLLGIEASKLPKSP
KIHPLQSRILDQKEDGCVVDMHHFNSGAQSVLAYATVNGSLVGWDLRSSSNAWTLKHDLK
SGLITSFAVDIHQCWLCIGTSSGTMACWDMRFQLPISSHCHPSRARIRRLSMHPLYQSWV
IAAVQGNNEVSMWDMETGDRRFTLWASSAPPLSELQPSPHSVHGIYCSPADGNPILLTAG
SDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRG
PESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK
GenBank ID Protein 83759166
UniProtKB/Swiss-Prot ID Q99570
UniProtKB/Swiss-Prot Entry Name PI3R4_HUMAN
PDB IDs Not Available
GenBank Gene ID BC110318
GeneCard ID PIK3R4
GenAtlas ID PIK3R4
HGNC ID HGNC:8982
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  5. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  6. Matsunaga K, Saitoh T, Tabata K, Omori H, Satoh T, Kurotori N, Maejima I, Shirahama-Noda K, Ichimura T, Isobe T, Akira S, Noda T, Yoshimori T: Two Beclin 1-binding proteins, Atg14L and Rubicon, reciprocally regulate autophagy at different stages. Nat Cell Biol. 2009 Apr;11(4):385-96. doi: 10.1038/ncb1846. Epub 2009 Mar 8. [PubMed:19270696 ]
  7. Panaretou C, Domin J, Cockcroft S, Waterfield MD: Characterization of p150, an adaptor protein for the human phosphatidylinositol (PtdIns) 3-kinase. Substrate presentation by phosphatidylinositol transfer protein to the p150.Ptdins 3-kinase complex. J Biol Chem. 1997 Jan 24;272(4):2477-85. [PubMed:8999962 ]