You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08853
Secondary Accession Numbers
  • 14580
Name N-acetylaspartyl-glutamate synthetase A
Synonyms
  1. NAAG synthetase A
  2. NAAGS
  3. Ribosomal protein S6 modification-like protein A
Gene Name RIMKLA
Protein Type Unknown
Biological Properties
General Function Involved in catalytic activity
Specific Function Catalyzes the synthesis of N-acetylaspartyl-glutamate (NAAG).
Pathways Not Available
Reactions
Adenosine triphosphate + N-Acetyl-L-aspartic acid + L-Glutamic acid → ADP + Phosphate + N-acetylaspartyl-glutamate details
GO Classification
Biological Process
cellular protein modification process
Cellular Component
cytoplasm
Function
binding
catalytic activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
Molecular Function
metal ion binding
ATP binding
acid-amino acid ligase activity
N-acetyl-L-aspartate-L-glutamate ligase activity
Process
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1p34.2
SNPs RIMKLA
Gene Sequence
>1176 bp
ATGTGCTCCCAGCTCTGGTTCCTGACGGACCGGCGCATCCGCGAGGACTACCCGCAGGTG
CAGATCCTGCGCGCCCTCCGGCAGCGCTGCTCCGAGCAGGACGTGCGCTTCCGGGCGGTG
CTTATGGACCAGATCGCCGTCACCATCGTCGGCGGCCACCTCGGCCTCCAGCTAAACCAG
AAGGCCCTCACCACTTTCCCGGATGTGGTGCTTGTACGGGTACCCACACCCTCAGTGCAG
TCAGACAGTGACATCACTGTCCTGCGACACCTGGAGAAGCTGGGCTGCCGGTTGGTCAAT
CGCCCACAGAGCATCTTAAATTGCATCAACAAATTCTGGACGTTCCAAGAACTGGCTGGA
CATGGGGTCCCCATGCCAGACACCTTCTCCTATGGTGGGCATGAAGACTTTTCAAAAATG
ATTGATGAAGCTGAGCCCCTGGGCTACCCAGTCGTGGTGAAGAGCACACGAGGCCACCGG
GGAAAAGCTGTTTTTCTGGCAAGAGATAAACATCACCTCTCTGACATCTGCCATCTGATC
CGCCACGATGTGCCCTACCTGTTCCAGAAGTACGTGAAGGAGTCCCATGGAAAGGACATC
CGGGTGGTGGTGGTAGGGGGCCAGGTCATAGGCTCTATGCTTCGCTGCTCCACTGATGGA
CGGATGCAGAGCAACTGCTCTCTCGGTGGCGTGGGCGTCAAGTGTCCGCTGACAGAACAA
GGCAAGCAGTTGGCTATTCAGGTGTCCAACATCCTAGGCATGGACTTCTGTGGCATTGAT
CTCCTTATCATGGACGATGGCTCCTTTGTGGTGTGTGAGGCAAATGCTAATGTTGGCTTC
CTAGCCTTTGACCAGGCATGCAACTTAGATGTGGGTGGGATCATTGCAGACTATACCATG
TCCTTGCTGCCAAATAGGCAGACTGGAAAGATGGCTGTCCTCCCAGGACTGTCGAGTCCA
AGGGAGAAGAACGAGCCGGATGGCTGTGCTTCAGCTCAGGGAGTTGCAGAGAGCGTCTAT
ACCATCAACAGTGGGTCTACCTCTAGTGAAAGTGAGCCTGAACTGGGAGAGATCCGGGAT
TCCTCAGCAAGCACAATGGGGGCCCCACCCTCCATGCTGCCCGAACCTGGCTACAACATT
AACAACAGGATTGCTTCTGAGTTAAAACTTAAGTGA
Protein Properties
Number of Residues 391
Molecular Weight 42863.8
Theoretical pI 6.675
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Ribosomal protein S6 modification-like protein A
MCSQLWFLTDRRIREDYPQVQILRALRQRCSEQDVRFRAVLMDQIAVTIVGGHLGLQLNQ
KALTTFPDVVLVRVPTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLI
RHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCSLGGVGVKCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGGIIADYTM
SLLPNRQTGKMAVLPGLSSPREKNEPDGCASAQGVAESVYTINSGSTSSESEPELGEIRD
SSASTMGAPPSMLPEPGYNINNRIASELKLK
GenBank ID Protein 187761273
UniProtKB/Swiss-Prot ID Q8IXN7
UniProtKB/Swiss-Prot Entry Name RIMKA_HUMAN
PDB IDs Not Available
GenBank Gene ID AL513331
GeneCard ID RIMKLA
GenAtlas ID RIMKLA
HGNC ID HGNC:28725
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]