Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08854
Secondary Accession Numbers
  • 14581
Name Beta-citryl-glutamate synthase B
Synonyms
  1. N-acetyl-aspartyl-glutamate synthetase B
  2. Ribosomal protein S6 modification-like protein B
  3. NAAG synthetase B
  4. NAAGS
Gene Name RIMKLB
Protein Type Unknown
Biological Properties
General Function Involved in catalytic activity
Specific Function Catalyzes the synthesis of beta-citryl-glutamate and N-acetyl-aspartyl-glutamate. Beta-citryl-glutamate is synthesized more efficiently than N-acetyl-aspartyl-glutamate (By similarity).
Pathways Not Available
Reactions
Adenosine triphosphate + Citric acid + L-Glutamic acid → ADP + Phosphate + beta-citryl-L-glutamate details
Adenosine triphosphate + N-Acetyl-L-aspartic acid + L-Glutamic acid → ADP + Phosphate + N-acetylaspartyl-glutamate details
GO Classification
Biological Process
cellular protein modification process
Cellular Component
cytoplasm
Function
binding
catalytic activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
Molecular Function
metal ion binding
ATP binding
acid-amino acid ligase activity
N-acetyl-L-aspartate-L-glutamate ligase activity
citrate-L-glutamate ligase activity
Process
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
Cellular Location Not Available
Gene Properties
Chromosome Location 12
Locus 12p13.31
SNPs RIMKLB
Gene Sequence
>1161 bp
ATGTGTAGTTCTGTGGCTGCCAAGTTGTGGTTTTTGACAGATCGTCGCATCAGGGAAGAC
TATCCTCAAAAAGAGATTTTACGAGCATTGAAGGCCAAATGTTGTGAGGAGGAACTGGAC
TTTAGGGCTGTGGTGATGGATGAGGTGGTGCTGACAATCGAGCAAGGAAACCTGGGTCTG
CGGATCAATGGAGAGCTAATCACTGCCTACCCACAAGTGGTGGTAGTCAGAGTACCAACC
CCTTGGGTGCAAAGTGATAGTGACATCACTGTTTTGCGCCATCTAGAGAAGATGGGATGT
CGGTTAATGAACCGACCTCAAGCCATCCTGAACTGCGTTAATAAGTTCTGGACATTTCAA
GAGTTGGCTGGCCATGGTGTTCCTCTGCCGGATACTTTCTCTTATGGTGGCCACGAAAAT
TTTGCTAAAATGATTGATGAGGCTGAAGTTCTGGAGTTCCCAATGGTAGTAAAGAATACG
CGGGGTCACAGAGGTAAAGCTGTTTTCTTGGCTCGAGATAAGCACCATTTGGCTGATCTA
AGCCATCTTATTCGCCATGAAGCGCCATACCTGTTCCAGAAGTATGTTAAAGAGTCTCAT
GGACGGGATGTACGTGTCATTGTCGTGGGAGGCCGTGTGGTTGGCACCATGTTACGTTGT
TCAACAGATGGGAGAATGCAAAGCAACTGCTCATTAGGTGGTGTGGGGATGATGTGCTCA
TTGAGTGAACAAGGGAAGCAGCTAGCTATCCAGGTGTCTAATATCCTGGGGATGGATGTG
TGTGGCATTGACCTGCTGATGAAAGATGACGGCTCCTTCTGCGTCTGTGAGGCCAATGCA
AATGTAGGTTTCATCGCCTTTGATAAGGCTTGTAATCTAGATGTAGCTGGTATCATAGCA
GACTATGCCGCCTCCCTTCTACCCTCTGGCCGGCTCACCCGGCGTATGTCCCTGCTCTCC
GTGGTGTCCACTGCCAGTGAGACTAGTGAGCCGGAGCTGGGTCCCCCAGCCAGCACTGCT
GTTGACAACATGAGTGCAAGTTCCAGCTCTGTTGACAGCGACCCTGAAAGCACGGAGCGA
GAGCTGCTCACCAAGCTCCCAGGGGGCCTGTTCAACATGAACCAGCTGCTAGCCAATGAA
ATCAAACTACTGGTGGACTGA
Protein Properties
Number of Residues 386
Molecular Weight 42463.575
Theoretical pI 5.995
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Ribosomal protein S6 modification-like protein B
MCSSVAAKLWFLTDRRIREDYPQKEILRALKAKCCEEELDFRAVVMDEVVLTIEQGNLGL
RINGELITAYPQVVVVRVPTPWVQSDSDITVLRHLEKMGCRLMNRPQAILNCVNKFWTFQ
ELAGHGVPLPDTFSYGGHENFAKMIDEAEVLEFPMVVKNTRGHRGKAVFLARDKHHLADL
SHLIRHEAPYLFQKYVKESHGRDVRVIVVGGRVVGTMLRCSTDGRMQSNCSLGGVGMMCS
LSEQGKQLAIQVSNILGMDVCGIDLLMKDDGSFCVCEANANVGFIAFDKACNLDVAGIIA
DYAASLLPSGRLTRRMSLLSVVSTASETSEPELGPPASTAVDNMSASSSSVDSDPESTER
ELLTKLPGGLFNMNQLLANEIKLLVD
GenBank ID Protein 134254462
UniProtKB/Swiss-Prot ID Q9ULI2
UniProtKB/Swiss-Prot Entry Name RIMKB_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_020734.2
GeneCard ID RIMKLB
GenAtlas ID RIMKLB
HGNC ID HGNC:29228
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Nagase T, Ishikawa K, Kikuno R, Hirosawa M, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Oct 29;6(5):337-45. [PubMed:10574462 ]