You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08857
Secondary Accession Numbers
  • 14584
Name Xaa-Pro aminopeptidase 2
Synonyms
  1. Aminoacylproline aminopeptidase
  2. Membrane-bound APP
  3. Membrane-bound AmP
  4. Membrane-bound aminopeptidase P
  5. X-Pro aminopeptidase 2
  6. mAmP
Gene Name XPNPEP2
Protein Type Unknown
Biological Properties
General Function Involved in hydrolase activity
Specific Function A metalloprotease that may play a role in the inflammatory process and other reactions produced in response to injury or infection. May also play a role in the metabolism of the vasodilator bradykinin
Pathways Not Available
Reactions Not Available
GO Classification
Function
metalloexopeptidase activity
catalytic activity
hydrolase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
metallopeptidase activity
Process
metabolic process
macromolecule metabolic process
cellular process
protein metabolic process
proteolysis
Cellular Location
  1. Cell membrane
  2. Lipid-anchor
  3. GPI-anchor
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs XPNPEP2
Gene Sequence
>2025 bp
ATGGCCCGGGCTCACTGGGGCTGCTGCCCCTGGCTGGTCCTCCTCTGTGCTTGTGCCTGG
GGCCACACAAAGCCAGTGGACCTTGGAGGGCAGGATGTGAGAAACTGTTCCACCAACCCC
CCTTACCTTCCAGTTACTGTGGTCAATACCACAATGTCACTCACAGCCCTCCGCCAGCAG
ATGCAGACCCAGAATCTCTCAGCCTACATCATCCCAGGCACAGATGCTCACATGAACGAG
TACATCGGCCAACATGACGAGAGGCGTGCGTGGATTACAGGCTTTACAGGGTCTGCAGGA
ACTGCAGTGGTGACTATGAAGAAAGCAGCTGTCTGGACCGACAGTCGCTACTGGACTCAG
GCTGAGCGGCAGATGGACTGCAACTGGGAGCTCCATAAGGAAGTTGGCACCACTCCTATT
GTCACCTGGCTCCTCACCGAGATTCCTGCTGGAGGGCGTGTGGGTTTTGACCCCTTCCTC
TTGTCCATTGACACCTGGGAGAGTTATGATCTGGCCCTCCAAGGCTCTAACAGACAGCTG
GTGTCCATCACAACCAATCTTGTGGACCTGGTATGGGGATCAGAGAGGCCACCGGTTCCA
AATCAACCCATTTATGCCCTGCAGGAGGCATTCACAGGGAGCACTTGGCAGGAGAAAGTA
TCTGGCGTCCGAAGCCAGATGCAGAAGCATCAAAAGGTCCCGACTGCCGTCCTTCTGTCG
GCGCTTGAGGAGACGGCCTGGCTCTTCAACCTTCGAGCCAGTGACATCCCCTATAACCCC
TTCTTCTATTCCTACACGCTGCTCACAGACTCTTCTATTAGGTTGTTTGCAAACAAGAGT
CGCTTTAGCTCCGAAACCTTGAGCTATCTGAACTCCAGTTGCACAGGCCCCATGTGTGTG
CAAATCGAGGATTACAGCCAAGTTCGTGACAGCATCCAGGCCTACTCATTGGGAGATGTG
AGGATCTGGATTGGGACCAGCTATACCATGTATGGGATCTATGAAATGATACCCAAGGAG
AAACTCGTGACAGACACCTACTCCCCAGTGATGATGACCAAGGCAGTGAAGAACAGCAAG
GAGCAGGCCCTCCTCAAGGCCAGCCACGTGCGGGACGCTGTGGCTGTGATCCGGTACTTG
GTCTGGCTGGAGAAGAACGTGCCCAAAGGCACAGTGGATGAGTTCTCGGGGGCAGAGATC
GTGGACAAGTTCCGAGGAGAAGAACAGTTCTCCTCCGGACCCAGTTTTGAAACCATCTCT
GCTAGTGGTCTGAATGCTGCCCTGGCCCACTACAGCCCGACCAAGGAGCTGAACCGCAAG
CTGTCCTCAGATGAGATGTACCTGCTGGACTCTGGGGGGCAGTACTGGGACGGGACCACA
GACATCACCAGAACAGTCCACTGGGGCACCCCCTCTGCCTTCCAGAAGGAGGCATACACC
CGTGTGCTGATAGGAAATATTGACCTGTCCAGGCTCATCTTTCCCGCTGCTACATCAGGG
CGAATGGTGGAGGCCTTTGCCCGCAGAGCCTTGTGGGATGCTGGTCTCAATTATGGTCAT
GGGACAGGCCACGGCATTGGCAACTTCCTGTGTGTGCATGAGTGGCCAGTGGGATTCCAG
TCCAACAACATCGCTATGGCCAAGGGCATGTTCACTTCCATTGAACCTGGTTACTATAAG
GATGGAGAATTTGGGATCCGTCTCGAAGATGTGGCTCTCGTGGTAGAAGCAAAGACCAAG
TACCCAGGGAGCTACCTGACCTTTGAAGTGGTATCATTTGTGCCCTATGACCGGAACCTC
ATCGATGTCAGCCTGCTGTCTCCCGAGCATCTCCAGTACCTGAATCGCTACTACCAGACC
ATCCGGGAGAAGGTGGGTCCAGAGCTGCAGAGGCGCCAGCTACTAGAGGAGTTCGAGTGG
CTTCAACAGCACACAGAGCCCCTGGCCGCCAGGGCCCCAGACACCGCCTCCTGGGCCTCT
GTGTTAGTGGTCTCCACCCTTGCCATCCTTGGCTGGAGTGTCTAG
Protein Properties
Number of Residues 674
Molecular Weight 75624.2
Theoretical pI 5.91
Pfam Domain Function
Signals
  • 1-21
Transmembrane Regions
  • None
Protein Sequence
>Xaa-Pro aminopeptidase 2
MARAHWGCCPWLVLLCACAWGHTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQ
MQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQ
AERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQL
VSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLS
ALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCV
QIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPVMMTKAVKNSK
EQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETIS
ASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYT
RVLIGNIDLSRLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQ
SNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNL
IDVSLLSPEHLQYLNRYYQTIREKVGPELQRRQLLEEFEWLQQHTEPLAARAPDTASWAS
VLVVSTLAILGWSV
GenBank ID Protein 11066157
UniProtKB/Swiss-Prot ID O43895
UniProtKB/Swiss-Prot Entry Name XPP2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF195953
GeneCard ID XPNPEP2
GenAtlas ID XPNPEP2
HGNC ID HGNC:12823
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  3. Venema RC, Ju H, Zou R, Venema VJ, Ryan JW: Cloning and tissue distribution of human membrane-bound aminopeptidase P. Biochim Biophys Acta. 1997 Oct 9;1354(1):45-8. [PubMed:9375790 ]