You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08860
Secondary Accession Numbers
  • 14587
Name Putative L-aspartate dehydrogenase
Synonyms
  1. Aspartate dehydrogenase domain-containing protein
Gene Name ASPDH
Protein Type Unknown
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Specifically catalyzes the NAD or NADP-dependent dehydrogenation of L-aspartate to iminoaspartate (By similarity).
Pathways
  • NAD(+) biosynthesis
Reactions
L-Aspartic acid + Water + NAD(P)(+) → Oxalacetic acid + Ammonia + NAD(P)H details
GO Classification
Biological Process
NAD biosynthetic process
NADP catabolic process
Function
binding
nucleotide binding
catalytic activity
nadp or nadph binding
oxidoreductase activity, acting on the ch-nh2 group of donors
oxidoreductase activity
aspartate dehydrogenase activity
Molecular Function
aspartate dehydrogenase activity
NADP binding
Process
metabolic process
coenzyme biosynthetic process
pyridine nucleotide biosynthetic process
nicotinamide nucleotide biosynthetic process
nad biosynthetic process
cellular metabolic process
oxidoreduction coenzyme metabolic process
oxidation reduction
pyridine nucleotide metabolic process
nicotinamide nucleotide metabolic process
nadp metabolic process
nadp catabolic process
cofactor metabolic process
coenzyme metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus 19q13.33
SNPs ASPDH
Gene Sequence
>852 bp
ATGGCCGACAGGGGCCCGTGGAGGGTGGGCGTGGTGGGCTATGGCCGCCTCGGACAGTCC
CTCGTCTCCCGCCTCTTGGCTCAGGGACCAGAACTTGGCCTAGAACTTGTTTTTGTCTGG
AATCGTGACCCAGGACGAATGGCAGGGAGCGTGCCCCCTTCCCTGCAGCTCCAGAACCTT
GCTGCCCTTGGGGAAAGGCGCCCTGATCTGGTTGTGGAAGTGGCCCATCCCAAAATAATC
CATGAATCTGGGGCACAAATCCTGCGCCATGCCAATCTCCTGGTGGGGTCCCCCTCAGCT
CTAAGTGACCAGACCACAGAGCGGCAGCTCTTGGAGGCCTCACAGCACTGGGACCACGCC
GTGTTTGTGGCCCGAGGGGCCCTGTGGGGCGCTGAGGACATCAGGAGATTGGATGCAGCT
GGGGGCCTCCGGAGCCTTCGTGTCACCATGGCCACACACCCCGATGGCTTCCGGCTTGAG
GGACCCCTGGCTGCAGCCCACAGCCCTGGGCCTTGCACTGTGCTCTACGAAGGCCCTGTC
CGTGGGCTCTGCCCCTTTGCCCCGCGAAATTCCAACACCATGGCGGCGGCTGCCCTGGCT
GCCCCCAGCCTGGGCTTCGATGGGGTGATTGGGGTGCTCGTGGCTGATACCAGCCTCACG
GACATGCACGTGGTGGATGTAGAGCTGAGCGGACCCCGGGGCCCCACGGGCCGAAGCTTT
GCTGTGCACACCCGCAGAGAGAACCCTGCCGAGCCAGGCGCGGTCACCGGCTCCGCCACC
GTCACGGCCTTCTGGCAGAGCCTCCTGGCCTGCTGCCAGCTCCCCTCCAGGCCGGGGATC
CATCTCTGCTGA
Protein Properties
Number of Residues 283
Molecular Weight 18655.255
Theoretical pI 8.147
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Putative L-aspartate dehydrogenase
MADRGPWRVGVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQNL
AALGERRPDLVVEVAHPKIIHESGAQILRHANLLVGSPSALSDQTTERQLLEASQHWDHA
VFVARGALWGAEDIRRLDAAGGLRSLRVTMATHPDGFRLEGPLAAAHSPGPCTVLYEGPV
RGLCPFAPRNSNTMAAAALAAPSLGFDGVIGVLVADTSLTDMHVVDVELSGPRGPTGRSF
AVHTRRENPAEPGAVTGSATVTAFWQSLLACCQLPSRPGIHLC
GenBank ID Protein 167736378
UniProtKB/Swiss-Prot ID A6ND91
UniProtKB/Swiss-Prot Entry Name ASPD_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001114598.1
GeneCard ID ASPDH
GenAtlas ID ASPDH
HGNC ID HGNC:33856
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]