You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08862
Secondary Accession Numbers
  • 14589
Name 17-beta-hydroxysteroid dehydrogenase 14
Synonyms
  1. 17-beta-HSD 14
  2. 17-beta-hydroxysteroid dehydrogenase DHRS10
  3. Dehydrogenase/reductase SDR family member 10
  4. Retinal short-chain dehydrogenase/reductase retSDR3
Gene Name HSD17B14
Protein Type Unknown
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Has NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity. Converts oestradiol to oestrone. The physiological substrate is not known. Acts on oestradiol and 5-androstene-3- beta,17-beta-diol (in vitro)
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
oxidoreductase activity
Process
metabolic process
oxidation reduction
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.33
SNPs HSD17B14
Gene Sequence
>813 bp
ATGGCTACGGGAACGCGCTATGCCGGGAAGGTGGTGGTCGTGACCGGGGGCGGGCGCGGC
ATCGGAGCTGGGATCGTGCGCGCCTTCGTGAACAGCGGGGCCCGAGTGGTTATCTGCGAC
AAGGATGAGTCTGGGGGCCGGGCCCTGGAGCAGGAGCTCCCTGGAGCTGTCTTTATCCTC
TGTGATGTGACTCAGGAAGATGATGTGAAGACCCTGGTTTCTGAGACCATCCGCCGATTT
GGCCGCCTGGATTGTGTTGTCAACAACGCTGGCCACCACCCACCCCCACAGAGGCCTGAG
GAGACCTCTGCCCAGGGATTCCGCCAGCTGCTGGAGCTGAACCTACTGGGGACGTACACC
TTGACCAAGCTCGCCCTCCCCTACCTGCGGAAGAGTCAAGGGAATGTCATCAACATCTCC
AGCCTGGTGGGGGCAATCGGCCAGGCCCAGGCAGTTCCCTATGTGGCCACCAAGGGGGCA
GTAACAGCCATGACCAAAGCTTTGGCCCTGGATGAAAGTCCATATGGTGTCCGAGTCAAC
TGTATCTCCCCAGGAAACATCTGGACCCCGCTGTGGGAGGAGCTGGCAGCCTTAATGCCA
GACCCTAGGGCCTCAATCCGAGAGGGCATGCTGGCCCAGCCACTGGGCCGCATGGGCCAG
CCCGCTGAGGTCGGGGCTGCGGCAGTGTTCCTGGCCTCCGAAGCCAACTTCTGCACGGGC
ATTGAACTGCTCGTGACGGGGGGTGCAGAGCTGGGGTACGGGTGCAAGGCCAGTCGGAGC
ACCCCCGTGGACGCCCCCGATATCCCTTCCTGA
Protein Properties
Number of Residues 270
Molecular Weight 28317.2
Theoretical pI 5.86
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>17-beta-hydroxysteroid dehydrogenase 14
MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFIL
CDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYT
LTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVN
CISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTG
IELLVTGGAELGYGCKASRSTPVDAPDIPS
GenBank ID Protein 6318546
UniProtKB/Swiss-Prot ID Q9BPX1
UniProtKB/Swiss-Prot Entry Name DHB14_HUMAN
PDB IDs
GenBank Gene ID AF126781
GeneCard ID HSD17B14
GenAtlas ID HSD17B14
HGNC ID HGNC:23238
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed:12975309 ]
  3. Haeseleer F, Palczewski K: Short-chain dehydrogenases/reductases in retina. Methods Enzymol. 2000;316:372-83. [PubMed:10800688 ]
  4. Lukacik P, Keller B, Bunkoczi G, Kavanagh KL, Lee WH, Adamski J, Oppermann U: Structural and biochemical characterization of human orphan DHRS10 reveals a novel cytosolic enzyme with steroid dehydrogenase activity. Biochem J. 2007 Mar 15;402(3):419-27. [PubMed:17067289 ]