You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08866
Secondary Accession Numbers
  • 14593
Name Nucleoredoxin
Synonyms Not Available
Gene Name NXN
Protein Type Unknown
Biological Properties
General Function Involved in antioxidant activity
Specific Function Functions as a redox-dependent negative regulator of the Wnt signaling pathway. May function as a transcriptional regulator. May regulate phosphatase 2A
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
antioxidant activity
oxidoreductase activity
Process
cellular process
cellular homeostasis
cell redox homeostasis
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. cytosol
Gene Properties
Chromosome Location Chromosome:1
Locus 17p13.3
SNPs NXN
Gene Sequence
>1308 bp
ATGTCGGGCTTCCTGGAGGAGCTGCTCGGCGAGAAGCTGGTGACGGGCGGCGGCGAGGAG
GTGGACGTGCACTCGCTGGGCGCCCGCGGCATCTCGCTGCTGGGTCTCTACTTCGGCTGC
AGCCTCAGCGCCCCCTGCGCGCAGCTCAGCGCCAGCCTGGCCGCCTTCTACGGGCGCCTG
CGGGGGGACGCGGCGGCCGGGCCGGGGCCGGGAGCGGGGGCCGGGGCGGCGGCGGAGCCC
GAGCCGCGGCGGCGCCTGGAGATCGTCTTCGTGTCCTCGGACCAGGACCAGCGGCAGTGG
CAGGACTTCGTGCGGGACATGCCGTGGCTGGCGCTGCCCTACAAGGAGAAGCACAGGAAG
CTCAAACTTTGGAACAAATACCGAATTTCCAACATTCCATCACTAATATTCCTCGACGCC
ACCACTGGGAAGGTTGTGTGCAGGAACGGGCTGCTGGTGATCCGAGATGACCCAGAAGGT
CTGGAGTTCCCCTGGGGACCGAAACCCTTCAGGGAAGTCATTGCAGGGCCCTTGCTTAGA
AACAATGGGCAGTCTCTGGAGAGCAGCAGCCTGGAGGGGTCTCACGTGGGCGTCTATTTC
TCCGCACATTGGTGTCCGCCCTGCCGAAGCCTCACCCGGGTCCTGGTGGAATCCTACCGG
AAGATCAAGGAGGCAGGCCAGAACTTCGAGATCATCTTCGTTAGTGCAGACAGGTCGGAG
GAGTCCTTCAAACAGTACTTCAGTGAGATGCCCTGGCTCGCCGTCCCCTACACGGATGAG
GCCCGGCGGTCGCGCCTCAACCGGCTGTACGGAATCCAAGGCATCCCCACGCTCATCATG
CTGGACCCGCAGGGCGAGGTGATCACGCGGCAGGGGCGGGTGGAGGTGCTGAACGACGAG
GACTGCCGGGAGTTCCCCTGGCACCCCAAGCCCGTGCTGGAGCTCTCCGACTCCAACGCC
GCGCAGCTTAACGAGGGCCCCTGCCTCGTCCTTTTTGTAGATTCTGAGGATGACGGAGAG
TCCGAGGCGGCCAAGCAGCTGATTCAGCCGATAGCTGAGAAAATCATTGCCAAGTACAAA
GCCAAAGAGGAGGAGGCACCCCTTCTGTTCTTCGTAGCCGGGGAGGATGACATGACTGAC
TCCCTGCGAGATTACACCAACCTGCCTGAGGCTGCCCCTTTGCTCACCATCCTGGACATG
TCAGCCCGGGCCAAGTACGTGATGGACGTGGAGGAGATCACCCCCGCCATCGTGGAGGCC
TTTGTGAATGACTTCCTAGCAGAGAAGCTCAAACCGGAGCCCATCTAG
Protein Properties
Number of Residues 435
Molecular Weight 48391.6
Theoretical pI 4.6
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Nucleoredoxin
MSGFLEELLGEKLVTGGGEEVDVHSLGARGISLLGLYFGCSLSAPCAQLSASLAAFYGRL
RGDAAAGPGPGAGAGAAAEPEPRRRLEIVFVSSDQDQRQWQDFVRDMPWLALPYKEKHRK
LKLWNKYRISNIPSLIFLDATTGKVVCRNGLLVIRDDPEGLEFPWGPKPFREVIAGPLLR
NNGQSLESSSLEGSHVGVYFSAHWCPPCRSLTRVLVESYRKIKEAGQNFEIIFVSADRSE
ESFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIMLDPQGEVITRQGRVEVLNDE
DCREFPWHPKPVLELSDSNAAQLNEGPCLVLFVDSEDDGESEAAKQLIQPIAEKIIAKYK
AKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVEEITPAIVEA
FVNDFLAEKLKPEPI
GenBank ID Protein 33149331
UniProtKB/Swiss-Prot ID Q6DKJ4
UniProtKB/Swiss-Prot Entry Name NXN_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_022463.3
GeneCard ID NXN
GenAtlas ID NXN
HGNC ID HGNC:18008
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196 ]
  4. Lechward K, Sugajska E, de Baere I, Goris J, Hemmings BA, Zolnierowicz S: Interaction of nucleoredoxin with protein phosphatase 2A. FEBS Lett. 2006 Jun 26;580(15):3631-7. Epub 2006 Jun 2. [PubMed:16764867 ]