Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08867
Secondary Accession Numbers
  • 14594
Name Poly [ADP-ribose] polymerase 10
Synonyms
  1. PARP-10
  2. ADP-ribosyltransferase diphtheria toxin-like 10
  3. ARTD10
Gene Name PARP10
Protein Type Unknown
Biological Properties
General Function Involved in nucleotide binding
Specific Function May play a role in cell proliferation. May be required for the maintenance of cell cycle progression.
Pathways Not Available
Reactions
NAD + (ADP-D-ribosyl)(n)-acceptor → Niacinamide + (ADP-D-ribosyl)(n+1)-acceptor details
GO Classification
Biological Process
negative regulation of fibroblast proliferation
protein poly-ADP-ribosylation
regulation of chromatin assembly
Cellular Component
Golgi apparatus
nucleus
Function
catalytic activity
transferase activity
nad+ adp-ribosyltransferase activity
transferase activity, transferring pentosyl groups
transferase activity, transferring glycosyl groups
Molecular Function
NAD+ ADP-ribosyltransferase activity
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. nucleolus
Gene Properties
Chromosome Location 8
Locus 8q24.3
SNPs PARP10
Gene Sequence
>3078 bp
ATGGTTGCAATGGCGGAGGCAGAGGCAGGGGTGGCAGTGGAGGTCCGTGGACTGCCCCCT
GCCGTGCCCGACGAGCTGCTCACTCTCTACTTTGAAAACCGCCGACGCTCTGGAGGGGGA
CCTGTGTTGAGCTGGCAGAGACTGGGCTGTGGGGGCGTCCTCACCTTCAGAGAGCCTGCA
GACGCCGAGAGGGTCTTGGCCCAGGCAGATCACGAACTACATGGTGCCCAGCTGAGCCTG
CGGCCAGCTCCACCACGAGCCCCTGCACGCCTGCTGCTCCAAGGACTGCCCCCTGGCACC
ACGCCCCAGCGCTTGGAGCAGCATGTCCAGGCCTTGCTGCGGGCCTCGGGGCTCCCAGTA
CAGCCTTGCTGTGCCTTGGCCAGCCCCCGGCCAGACCGGGCTCTGGTCCAGTTGCCCAAG
CCCCTTTCTGAGGCAGATGTCCGTGTCCTGGAGGAGCAGGCCCAGAATCTGGGCCTGGAG
GGGACCTTGGTGTCCCTGGCCCGGGTTCCCCAGGCCCGAGCGGTGCGTGTGGTGGGGGAT
GGTGCCTCTGTGGACCTGCTGTTGCTGGAGTTGTACCTGGAGAATGAGCGCCGCAGTGGT
GGGGGGCCCCTGGAGGACCTGCAACGCCTACCCGGGCCCCTGGGCACTGTTGCCTCCTTC
CAGCAGTGGCAAGTGGCAGAACGAGTGTTGCAGCAGGAGCACCGGTTGCAGGGCTCAGAG
CTGAGCCTTGTCCCCCACTACGACATCCTGGAGCCCGAGGAGCTGGCTGAGAACACCAGT
GGAGGGGACCACCCGTCCACCCAGGGGCCTAGGGCTACCAAGCATGCTCTCCTGAGGACC
GGAGGGTTGGTGACGGCTCTGCAGGGTGCAGGGACTGTGACAATGGGCTCTGGCGAGGAA
CCAGGGCAGTCAGGGGCCTCTCTGAGGACAGGTCCCATGGTGCAGGGTAGAGGGATTATG
ACAACAGGCTCTGGCCAGGAACCAGGGCAGTCAGGGACCTCTCTGAGGACAGGTCCCATG
GGGTCTCTGGGACAGGCAGAGCAAGTCAGCTCGATGCCCATGGGGTCTCTGGAACATGAG
GGGCTGGTAAGCCTGAGGCCTGTGGGGTTGCAGGAACAGGAGGGGCCCATGAGCCTGGGG
CCTGTGGGGTCTGCAGGCCCAGTGGAGACCTCTAAGGGGTTGCTGGGGCAGGAGGGCCTG
GTGGAAATTGCCATGGACTCACCAGAGCAAGAGGGGCTGGTGGGTCCCATGGAGATCACC
ATGGGGTCTCTGGAGAAGGCAGGGCCTGTGAGCCCAGGATGTGTGAAGCTGGCAGGGCAG
GAGGGCCTGGTGGAGATGGTGCTATTGATGGAGCCAGGGGCGATGCGCTTCCTGCAGCTC
TACCATGAGGACCTTCTTGCGGGCCTGGGAGACGTCGCTCTCTTGCCACTTGAAGGACCG
GATATGACTGGCTTTCGGCTCTGTGGAGCCCAGGCTTCCTGCCAGGCGGCTGAGGAGTTT
CTGCGGAGCCTGCTGGGCAGCATTAGCTGCCATGTGTTGTGCCTGGAGCACCCGGGCAGC
GCCAGGTTTCTCCTGGGCCCAGAAGGGCAGCACCTTCTCCAGGGGCTGGAGGCTCAGTTC
CAGTGTGTCTTTGGGACAGAGCGCCTGGCCACAGCCACGTTGGACACAGGCCTTGAAGAG
GTGGACCCTACCGAGGCCCTCCCAGTGCTCCCTGGCAACGCCCACACCCTGTGGACCCCA
GACAGTACAGGTGGTGACCAGGAGGACGTGAGCCTGGAGGAGGTCCGAGAACTGCTGGCC
ACCCTGGAGGGCCTAGACCTAGACGGGGAGGACTGGCTGCCTCGGGAGCTGGAGGAGGAA
GGGCCTCAGGAGCAGCCAGAGGAGGAGGTGACCCCAGGGCATGAGGAGGAGGAGCCTGTG
GCCCCCAGCACTGTGGCACCCAGGTGGCTGGAGGAGGAGGCCGCTCTGCAGCTGGCCCTC
CACCGGTCACTGGAGCCTCAAGGTCAGGTGGCTGAGCAGGAGGAGGCTGCTGCCCTGCGG
CAAGCCCTAACCCTCTCCCTGCTGGAGCAGCCCCCGTTGGAGGCAGAAGAGCCCCCAGAT
GGGGGGACTGATGGCAAGGCCCAGCTGGTGGTGCACTCGGCCTTTGAGCAGGATGTGGAG
GAGCTGGACCGGGCGCTCAGGGCTGCCTTGGAGGTCCACGTCCAGGAGGAGACGGTGGGG
CCCTGGCGCCGCACACTGCCTGCAGAGCTGCGTGCTCGCCTGGAGCGGTGCCATGGTGTG
AGTGTTGCCCTGCGTGGTGACTGCACCATCCTCCGTGGCTTCGGGGCCCACCCTGCCCGT
GCTGCCCGCCACTTGGTGGCACTTCTGGCTGGCCCCTGGGATCAGAGTTTGGCCTTTCCC
TTGGCAGCTTCAGGCCCTACCTTGGCGGGGCAGACGCTGAAGGGGCCCTGGAACAACCTG
GAGCGTCTGGCAGAGAACACCGGGGAGTTCCAGGAGGTGGTGCGGGCCTTCTACGACACC
CTGGACGCTGCCCGCAGCAGCATCCGCGTCGTTCGTGTGGAGCGCGTGTCGCACCCGCTG
CTGCAGCAGCAGTATGAGCTGTACCGGGAGCGCCTGCTGCAGCGATGCGAGCGGCGCCCG
GTGGAGCAGGTGCTGTACCACGGCACGACGGCACCGGCAGTGCCTGACATCTGCGCCCAC
GGCTTCAACCGCAGCTTCTGCGGCCGCAACGCCACGGTCTACGGGAAGGGCGTGTATTTC
GCCAGGCGCGCCTCCCTGTCGGTGCAGGACCGCTACTCGCCCCCCAACGCCGATGGCCAT
AAGGCGGTGTTCGTGGCACGGGTGCTGACTGGCGACTACGGGCAGGGCCGCCGCGGTCTG
CGGGCGCCCCCTCTGCGGGGTCCTGGCCACGTGCTCCTGCGCTACGACAGCGCCGTGGAC
TGCATCTGCCAGCCCAGCATCTTCGTCATCTTCCACGACACCCAGGCGCTGCCCACCCAC
CTCATCACCTGCGAGCACGTGCCCCGCGCTTCCCCCGGCGACCCCTCTGGGCTCCCGGGC
CGCTCCCCAGACACTTAA
Protein Properties
Number of Residues 1025
Molecular Weight 109997.35
Theoretical pI 4.968
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Poly [ADP-ribose] polymerase 10
MVAMAEAEAGVAVEVRGLPPAVPDELLTLYFENRRRSGGGPVLSWQRLGCGGVLTFREPA
DAERVLAQADHELHGAQLSLRPAPPRAPARLLLQGLPPGTTPQRLEQHVQALLRASGLPV
QPCCALASPRPDRALVQLPKPLSEADVRVLEEQAQNLGLEGTLVSLARVPQARAVRVVGD
GASVDLLLLELYLENERRSGGGPLEDLQRLPGPLGTVASFQQWQVAERVLQQEHRLQGSE
LSLVPHYDILEPEELAENTSGGDHPSTQGPRATKHALLRTGGLVTALQGAGTVTMGSGEE
PGQSGASLRTGPMVQGRGIMTTGSGQEPGQSGTSLRTGPMGSLGQAEQVSSMPMGSLEHE
GLVSLRPVGLQEQEGPMSLGPVGSAGPVETSKGLLGQEGLVEIAMDSPEQEGLVGPMEIT
MGSLEKAGPVSPGCVKLAGQEGLVEMVLLMEPGAMRFLQLYHEDLLAGLGDVALLPLEGP
DMTGFRLCGAQASCQAAEEFLRSLLGSISCHVLCLEHPGSARFLLGPEGQHLLQGLEAQF
QCVFGTERLATATLDTGLEEVDPTEALPVLPGNAHTLWTPDSTGGDQEDVSLEEVRELLA
TLEGLDLDGEDWLPRELEEEGPQEQPEEEVTPGHEEEEPVAPSTVAPRWLEEEAALQLAL
HRSLEPQGQVAEQEEAAALRQALTLSLLEQPPLEAEEPPDGGTDGKAQLVVHSAFEQDVE
ELDRALRAALEVHVQEETVGPWRRTLPAELRARLERCHGVSVALRGDCTILRGFGAHPAR
AARHLVALLAGPWDQSLAFPLAASGPTLAGQTLKGPWNNLERLAENTGEFQEVVRAFYDT
LDAARSSIRVVRVERVSHPLLQQQYELYRERLLQRCERRPVEQVLYHGTTAPAVPDICAH
GFNRSFCGRNATVYGKGVYFARRASLSVQDRYSPPNADGHKAVFVARVLTGDYGQGRRGL
RAPPLRGPGHVLLRYDSAVDCICQPSIFVIFHDTQALPTHLITCEHVPRASPDDPSGLPG
RSPDT
GenBank ID Protein 62897387
UniProtKB/Swiss-Prot ID Q53GL7
UniProtKB/Swiss-Prot Entry Name PAR10_HUMAN
PDB IDs
GenBank Gene ID AK222914
GeneCard ID PARP10
GenAtlas ID PARP10
HGNC ID HGNC:25895
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Yu M, Schreek S, Cerni C, Schamberger C, Lesniewicz K, Poreba E, Vervoorts J, Walsemann G, Grotzinger J, Kremmer E, Mehraein Y, Mertsching J, Kraft R, Austen M, Luscher-Firzlaff J, Luscher B: PARP-10, a novel Myc-interacting protein with poly(ADP-ribose) polymerase activity, inhibits transformation. Oncogene. 2005 Mar 17;24(12):1982-93. [PubMed:15674325 ]
  5. Chou HY, Chou HT, Lee SC: CDK-dependent activation of poly(ADP-ribose) polymerase member 10 (PARP10). J Biol Chem. 2006 Jun 2;281(22):15201-7. Epub 2006 Feb 2. [PubMed:16455663 ]