Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08868
Secondary Accession Numbers
  • 14595
Name Poly [ADP-ribose] polymerase 11
Synonyms
  1. PARP-11
  2. ADP-ribosyltransferase diphtheria toxin-like 11
  3. ARTD11
Gene Name PARP11
Protein Type Unknown
Biological Properties
General Function Involved in NAD+ ADP-ribosyltransferase activity
Specific Function Not Available
Pathways Not Available
Reactions
NAD + (ADP-D-ribosyl)(n)-acceptor → Niacinamide + (ADP-D-ribosyl)(n+1)-acceptor details
GO Classification
Function
catalytic activity
transferase activity
nad+ adp-ribosyltransferase activity
transferase activity, transferring pentosyl groups
transferase activity, transferring glycosyl groups
Molecular Function
NAD+ ADP-ribosyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 12
Locus 12p13.3
SNPs PARP11
Gene Sequence
>996 bp
ATGTTTCACAAAGCAGAAGAATTATTTTCTAAAACAACAAACAATGAAGTGGATGACATG
GACACGTCAGATACCCAGTGGGGCTGGTTTTACTTGGCAGAATGTGGGAAGTGGCACATG
TTTCAGCCGGATACCAACAGTCAGTGTTCAGTTAGCAGTGAAGATATCGAAAAAAGCTTC
AAAACAAACCCTTGTGGCTCCATTTCTTTTACTACTTCCAAATTCAGCTACAAGATAGAC
TTTGCAGAAATGAAGCAAATGAATCTCACCACTGGAAAGCAGCGCTTAATAAAAAGAGCC
CCCTTTTCTATCAGTGCTTTCAGTTACATCTGTGAAAACGAGGCCATCCCTATGCCACCA
CACTGGGAGAATGTGAATACTCAAGTACCATATCAGCTTATTCCTCTGCACAATCAAACA
CATGAATATAATGAAGTTGCTAATCTCTTTGGGAAGACGATGGATCGCAACCGAATTAAA
AGAATTCAGAGAATTCAAAACCTAGATTTGTGGGAGTTCTTTTGCAGGAAAAAGGCTCAG
CTCAAGAAAAAAAGAGGTGTGCCTCAGATTAATGAACAAATGCTGTTTCATGGTACCAGC
AGTGAATTTGTGGAAGCAATCTGCATTCATAACTTTGATTGGAGAATAAATGGTATACAT
GGTGCTGTCTTTGGAAAAGGAACCTATTTTGCTAGAGATGCTGCTTATTCCAGTCGTTTC
TGCAAAGATGACATAAAGCATGGGAACACATTCCAAATTCATGGTGTCAGCTTGCAACAG
CGGCATCTGTTTAGAACATATAAATCTATGTTTCTTGCTCGAGTGCTAATTGGAGATTAC
ATAAACGGAGACTCCAAATACATGCGACCTCCTTCCAAAGACGGGAGCTATGTGAATTTA
TATGACAGCTGTGTGGATGATACCTGGAACCCAAAGATCTTTGTGGTTTTTGATGCCAAC
CAAATCTATCCTGAGTACTTGATAGACTTTCATTGA
Protein Properties
Number of Residues 331
Molecular Weight 39596.545
Theoretical pI 7.295
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Poly [ADP-ribose] polymerase 11
MFHKAEELFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSF
KTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPP
HWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQ
LKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGAVFGKGTYFARDAAYSSRF
CKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNL
YDSCVDDTWNPKIFVVFDANQIYPEYLIDFH
GenBank ID Protein 9652076
UniProtKB/Swiss-Prot ID Q9NR21
UniProtKB/Swiss-Prot Entry Name PAR11_HUMAN
PDB IDs
GenBank Gene ID AF263540
GeneCard ID PARP11
GenAtlas ID PARP11
HGNC ID HGNC:1186
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]