You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08869
Secondary Accession Numbers
  • 14596
Name Poly [ADP-ribose] polymerase 12
Synonyms
  1. PARP-12
  2. Zinc finger CCCH domain-containing protein 1
  3. ADP-ribosyltransferase diphtheria toxin-like 12
  4. ARTD12
Gene Name PARP12
Protein Type Unknown
Biological Properties
General Function Involved in NAD+ ADP-ribosyltransferase activity
Specific Function Not Available
Pathways Not Available
Reactions
NAD + (ADP-D-ribosyl)(n)-acceptor → Niacinamide + (ADP-D-ribosyl)(n+1)-acceptor details
GO Classification
Cellular Component
nucleus
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
zinc ion binding
transferase activity
nad+ adp-ribosyltransferase activity
transferase activity, transferring pentosyl groups
nucleic acid binding
transferase activity, transferring glycosyl groups
Molecular Function
nucleic acid binding
metal ion binding
NAD+ ADP-ribosyltransferase activity
zinc ion binding
Cellular Location
  1. Nucleus (Probable)
Gene Properties
Chromosome Location 7
Locus 7q34
SNPs PARP12
Gene Sequence
>2106 bp
ATGGCCCAGGCCGGCGTCGTCGGTGAGGTCACCCAGGTGCTGTGCGCGGCCGGGGGCGCC
CTGGAGTTGCCCGAGCTGCGGCGCCGCTTGCGGATGGGCTTGAGCGCCGACGCGCTGGAG
CGGCTGCTGCGGCAGCGTGGGCGCTTCGTGGTGGCGGTGCGGGCGGGCGGCGCAGCCGCG
GCCCCGGAGCGCGTGGTGCTGGCCGCCTCGCCGCTGCGCCTGTGTCGCGCGCACCAGGGC
TCCAAGCCGGGCTGCGTGGGGCTCTGCGCGCAGCTCCACCTCTGCAGGTTCATGGTCTAC
GGCGCCTGCAAGTTCCTGAGAGCCGGGAAGAACTGTAGGAATAGTCACAGCTTGACAACC
GAACACAACCTGAGTGTGCTGAGAACTCATGGCGTTGACCACCTGAGCTATAATGAGCTA
TGCCAACTCTTGTTTCAGAACGACCCCTGGCTTTTGCCAGAAATTTGCCAACATTACAAC
AAAGGAGATGGACCCCACGGCTCTTGTGCCTTTCAAAAGCAGTGCATCAAGCTCCATATC
TGCCAGTATTTTTTACAGGGGGAATGCAAGTTTGGCACTAGCTGTAAGAGATCCCATGAT
TTCTCTAATTCTGAGAATCTGGAAAAATTGGAGAAGTTGGGTATGAGCTCAGACCTGGTG
AGCAGGCTGCCTACCATTTATAGAAATGCACATGACATCAAGAATAAGAGCTCTGCCCCC
AGCAGAGTGCCTCCTCTTTTTGTCCCACAGGGGACTTCTGAAAGAAAAGACAGTTCAGGT
TCTGTGTCCCCAAACACTCTTAGCCAGGAGGAGGGTGATCAGATCTGTTTGTACCATATC
CGGAAAAGTTGTAGCTTTCAAGATAAGTGCCATAGAGTTCATTTCCATTTGCCGTATCGA
TGGCAATTCTTGGATAGAGGCAAATGGGAGGATTTGGACAACATGGAACTTATTGAAGAG
GCATATTGCAATCCCAAAATAGAAAGGATCCTGTGCTCTGAGTCAGCCAGTACCTTTCAC
TCTCATTGTCTGAACTTTAACGCCATGACTTACGGTGCTACCCAGGCTCGCCGCCTCTCC
ACGGCCTCCTCTGTCACCAAACCTCCACACTTCATCCTCACCACTGACTGGATTTGGTAC
TGGAGTGATGAGTTTGGTTCTTGGCAGGAATATGGAAGACAGGGCACGGTGCACCCTGTG
ACCACTGTCAGCAGTAGCGACGTGGAGAAGGCCTACCTGGCCTACTGTACACCGGGGTCT
GACGGCCAGGCAGCCACCTTGAAGTTCCAGGCCGGAAAGCACAACTACGAGTTAGATTTC
AAAGCCTTCGTTCAGAAAAACCTGGTCTATGGCACAACTAAAAAGGTTTGCCGCAGACCC
AAATACGTGTCTCCCCAGGATGTGACGACCATGCAAACCTGCAATACCAAGTTTCCAGGC
CCGAAGAGCATCCCAGACTATTGGGACTCCTCTGCCCTGCCAGACCCAGGCTTTCAGAAG
ATCACCCTTAGTTCTTCCTCGGAAGAGTATCAGAAGGTCTGGAACCTCTTTAACCGCACG
CTGCCTTTCTACTTTGTTCAGAAGATTGAGCGAGTACAGAACCTGGCCCTCTGGGAAGTC
TACCAGTGGCAAAAAGGACAGATGCAGAAGCAGAATGGAGGGAAGGCCGTGGACGAGCGG
CAGCTGTTCCACGGCACCAGCGCCATTTTTGTGGACGCCATCTGCCAGCAGAACTTTGAC
TGGCGGGTCTGTGGTGTTCATGGCACTTCCTACGGCAAGGGGAGCTACTTTGCCCGAGAT
GCTGCATATTCCCACCACTACAGCAAATCCGACACGCAGACCCACACGATGTTCCTGGCC
CGGGTGCTGGTGGGCGAGTTCGTCAGGGGCAATGCGTCCTTTGTCCGTCCGCCGGCCAAG
GAGGGCTGGAGCAACGCCTTCTATGATAGCTGCGTGAACAGTGTGTCCGACCCCTCCATC
TTTGTGATCTTTGAGAAACACCAGGTCTACCCAGAGTATGTCATCCAGTACACCACCTCC
TCCAAGCCCTCGGTCACACCCTCCATCCTGCTGGCCTTGGGCTCCCTGTTCAGCAGCCGA
CAGTGA
Protein Properties
Number of Residues 701
Molecular Weight 79063.08
Theoretical pI 8.521
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Poly [ADP-ribose] polymerase 12
MAQAGVVGEVTQVLCAAGGALELPELRRRLRMGLSADALERLLRQRGRFVVAVRAGGAAA
APERVVLAASPLRLCRAHQGSKPGCVGLCAQLHLCRFMVYGACKFLRAGKNCRNSHSLTT
EHNLSVLRTHGVDHLSYNELCQLLFQNDPWLLPEICQHYNKGDGPHGSCAFQKQCIKLHI
CQYFLQGECKFGTSCKRSHDFSNSENLEKLEKLGMSSDLVSRLPTIYRNAHDIKNKSSAP
SRVPPLFVPQGTSERKDSSGSVSPNTLSQEEGDQICLYHIRKSCSFQDKCHRVHFHLPYR
WQFLDRGKWEDLDNMELIEEAYCNPKIERILCSESASTFHSHCLNFNAMTYGATQARRLS
TASSVTKPPHFILTTDWIWYWSDEFGSWQEYGRQGTVHPVTTVSSSDVEKAYLAYCTPGS
DGQAATLKFQAGKHNYELDFKAFVQKNLVYGTTKKVCRRPKYVSPQDVTTMQTCNTKFPG
PKSIPDYWDSSALPDPGFQKITLSSSSEEYQKVWNLFNRTLPFYFVQKIERVQNLALWEV
YQWQKGQMQKQNGGKAVDERQLFHGTSAIFVDAICQQNFDWRVCGVHGTSYGKGSYFARD
AAYSHHYSKSDTQTHTMFLARVLVGEFVRGNASFVRPPAKEGWSNAFYDSCVNSVSDPSI
FVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSLFSSRQ
GenBank ID Protein 12232413
UniProtKB/Swiss-Prot ID Q9H0J9
UniProtKB/Swiss-Prot Entry Name PAR12_HUMAN
PDB IDs
GenBank Gene ID NM_022750.2
GeneCard ID PARP12
GenAtlas ID PARP12
HGNC ID HGNC:21919
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. [PubMed:11230166 ]
  5. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]