Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08870
Secondary Accession Numbers
  • 14597
Name Poly [ADP-ribose] polymerase 14
Synonyms
  1. B aggressive lymphoma protein 2
  2. PARP-14
  3. ADP-ribosyltransferase diphtheria toxin-like 8
  4. ARTD8
Gene Name PARP14
Protein Type Unknown
Biological Properties
General Function Involved in NAD+ ADP-ribosyltransferase activity
Specific Function Enhances STAT6-dependent transcription (By similarity). Has ADP-ribosyltransferase activity.
Pathways Not Available
Reactions
NAD + (ADP-D-ribosyl)(n)-acceptor → Niacinamide + (ADP-D-ribosyl)(n+1)-acceptor details
GO Classification
Biological Process
regulation of transcription, DNA-dependent
transcription, DNA-dependent
Cellular Component
cytoplasm
plasma membrane
nucleus
Function
catalytic activity
transferase activity
nad+ adp-ribosyltransferase activity
transferase activity, transferring pentosyl groups
transferase activity, transferring glycosyl groups
Molecular Function
NAD+ ADP-ribosyltransferase activity
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location 3
Locus 3q21.1
SNPs PARP14
Gene Sequence
>5406 bp
ATGGCTGTGCCCGGCTCCTTCCCGCTGCTGGTCGAGGGCTCCTGGGGCCCCGACCCCCCG
AAGAACTTGAACACCAAGTTGCAGATGTACTTCCAGAGCCCGAAGAGGTCGGGAGGCGGC
GAGTGTGAGGTCCGCCAGGATCCCAGGAGCCCATCCCGCTTCCTGGTGTTCTTCTACCCG
GAGGACGTTCGGCAGAAGGTTCTGGAGAGAAAAAATCATGAGTTGGTATGGCAAGGAAAA
GGAACATTCAAGTTAACTGTCCAGTTACCTGCAACCCCAGATGAAATCGATCATGTCTTT
GAAGAGGAACTTCTAACAAAAGAATCCAAGACCAAAGAAGATGTTAAAGAACCAGATGTG
TCAGAAGAATTGGATACAAAACTCCCTCTTGATGGTGGATTAGACAAAATGGAAGATATC
CCAGAGGAATGTGAAAATATTTCCTCTTTGGTGGCATTTGAAAACCTCAAGGCAAATGTG
ACTGACATAATGCTAATCTTGTTAGTGGAGAACATAAGTGGCCTGTCTAATGATGACTTT
CAAGTGGAAATAATAAGAGATTTTGATGTTGCTGTTGTTACCTTTCAAAAGCACATAGAT
ACTATAAGATTTGTTGATGATTGTACCAAGCACCATTCAATTAAACAACTTCAGCTTTCT
CCAAGACTTCTGGAAGTGACAAACACAATCAGGGTTGAAAACCTGCCACCTGGTGCTGAT
GACTACAGTTTAAAACTTTTCTTTGAAAATCCCTATAATGGAGGGGGAAGAGTTGCCAAT
GTTGAATATTTTCCTGAAGAGAGTTCAGCTCTGATTGAATTTTTTGACAGAAAAGTGTTA
GACACCATCATGGCCACAAAACTCGACTTCAATAAAATGCCACTTTCTGTGTTCCCATAC
TATGCCTCATTGGGCACAGCCTTGTATGGAAAGGAGAAGCCTCTGATCAAGCTTCCAGCA
CCATTTGAAGAGTCACTAGATCTTCCCTTATGGAAGTTCTTACAGAAAAAGAATCACCTC
ATTGAGGAGATAAACGATGAAATGAGGCGTTGTCACTGTGAGCTCACGTGGTCCCAACTC
AGTGGTAAAGTTACCATCAGACCAGCAGCCACCTTAGTCAATGAAGGAAGACCGAGAATC
AAGACCTGGCAGGCAGATACTTCCACAACACTCTCTAGCATCAGGTCTAAATATAAAGTC
AACCCAATTAAAGTGGATCCAACAATGTGGGACACCATAAAAAATGATGTGAAAGATGAC
AGGATTTTGATTGAGTTTGATACACTTAAGGAGATGGTAATCTTAGCAGGGAAATCAGAG
GATGTCCAAAGCATTGAGGTACAAGTCAGGGAGTTAATAGAAAGCACTACTCAAAAAATT
AAAAGGGAAGAGCAAAGTTTGAAGGAAAAAATGATCATTTCTCCAGGCAGGTATTTTCTT
TTGTGTCACAGCAGTCTACTGGACCATTTACTCACGGAGTGCCCAGAGATAGAGATTTGT
TACGATAGAGTCACTCAACACTTGTGCTTGAAAGGACCTAGTGCAGATGTGTATAAAGCA
AAGTGTGAAATCCAGGAAAAGGTGTACACCATGGCTCAGAAAAACATTCAGGTTTCTCCT
GAGATTTTTCAGTTTTTGCAACAGGTAAACTGGAAAGAATTCTCTAAGTGTCTTTTCATA
GCACAGAAGATTCTTGCACTTTATGAGCTAGAGGGTACAACTGTTCTCTTAACCAGCTGT
TCTTCTGAAGCCCTGTTAGAAGCAGAAAAGCAAATGCTCAGTGCCTTAAATTATAAGCGC
ATTGAAGTTGAGAACAAAGAAGTTCTTCATGGCAAGAAATGGAAAGGGCTCACTCACAAT
TTGCTTAAGAAACAAAATTCCTCCCCAAACACTGTAATCATCAATGAGTTAACTTCAGAA
ACCACAGCTGAAGTCATCATTACAGGCTGTGTAAAAGAAGTAAATGAAACCTATAAATTG
CTTTTTAACTTCGTTGAACAAAACATGAAAATAGAGAGACTGGTTGAAGTAAAGCCTTCC
TTAGTTATTGACTATTTAAAGACAGAAAAGAAGCTATTCTGGCCAAAGATAAAGAAGGTA
AATGTGCAGGTAAGTTTCAATCCTGAGAACAAACAAAAAGGCATTTTACTAACTGGCTCA
AAGACCGAAGTACTGAAGGCAGTGGACATTGTCAAGCAAGTCTGGGATTCAGTCTGTGTT
AAAAGTGTCCATACTGATAAGCCAGGAGCCAAGCAGTTCTTCCAGGATAAAGCACGGTTT
TATCAAAGTGAGATCAAACGGTTGTTTGGTTGTTACATTGAACTACAGGAGAATGAAGTA
ATGAAGGAGGGAGGCAGCCCCGCTGGGCAGAAGTGCTTCTCTCGGACAGTCTTGGCCCCT
GGCGTTGTGCTGATTGTGCAGCAGGGTGACTTGGCACGGCTTCCTGTCGATGTGGTGGTG
AATGCATCTAATGAGGACCTTAAGCATTATGGTGGCCTGGCCGCTGCGCTCTCAAAAGCA
GCTGGCCCTGAGCTCCAGGCCGACTGTGACCAGATAGTGAAGAGAGAGGGCAGACTCCTA
CCGGGCAATGCCACCATCTCCAAGGCAGGAAAGCTGCCCTACCACCACGTGATCCATGCA
GTGGGGCCCCGCTGGAGCGGATATGAGGCCCCGAGGTGTGTGTACCTATTAAGGAGAGCT
GTGCAACTCAGTCTCTGTCTAGCCGAAAAATACAAGTACCGATCCATAGCCATCCCAGCT
ATTAGTTCTGGAGTCTTTGGCTTTCCCTTAGGCCGATGCGTGGAGACCATTGTTTCTGCC
ATCAAGGAAAACTTCCAATTCAAGAAGGATGGACACTGCTTGAAAGAAATCTACCTTGTG
GATGTATCTGAGAAGACTGTTGAGGCCTTTGCAGAAGCTGTGAAAACTGTATTTAAAGCC
ACCCTGCCAGATACAGCTGCCCCGCCAGGTTTACCACCAGCAGCAGCGGGGCCTGGGAAA
ACATCATGGGAAAAAGGAAGCCTGGTGTCCCCGGGAGGCCTGCAGATGCTGTTGGTGAAA
GAGGGTGTGCAGAATGCTAAGACCGATGTTGTTGTCAACTCCGTTCCCTTGGATCTCGTG
CTTAGTAGAGGGCCTCTTTCTAAGTCCCTCTTGGAAAAAGCTGGACCAGAGCTCCAGGAG
GAATTGGACACAGTTGGACAAGGGGTGGCTGTCAGCATGGGCACAGTGCTCAAAACCAGC
AGCTGGAATCTGGACTGTCGCTATGTGCTTCACGTGGTAGCTCCGGAGTGGAGAAATGGT
AGCACATCTTCACTCAAGATAATGGAAGACATAATCAGAGAATGTATGGAGATCACTGAG
AGCTTGTCCTTAAAATCAATTGCATTTCCAGCAATAGGAACAGGAAACTTGGGATTTCCT
AAAAACATATTCGCTGAATTAATCATTTCAGAGGTGTTCAAATTTAGTAGCAAGAATCAG
CTGAAAACTTTACAAGAGGTTCACTTTCTGCTGCACCCGAGTGATCATGAAAATATTCAG
GCATTTTCAGATGAATTTGCCAGAAGGGCTAATGGAAATCTCGTCAGTGACAAAATTCCG
AAGGCTAAAGATACACAAGGTTTTTATGGGACTGTTTCTAGCCCTGATTCAGGTGTGTAT
GAAATGAAGATTGGCTCCATCATCTTCCAGGTGGCTTCTGGAGATATCACGAAAGAAGAG
GCAGATGTGATTGTAAATTCAACATCAAACTCATTCAATCTCAAAGCAGGGGTCTCCAAA
GCAATTTTAGAATGTGCTGGACAAAATGTAGAAAGGGAATGTTCTCAGCAAGCTCAGCAG
CGCAAAAATGATTATATAATCACCGGAGGTGGATTTTTGAGGTGCAAGAATATCATTCAT
GTAATTGGTGGAAATGATGTCAAGAGTTCAGTTTCCTCTGTTTTGCAGGAGTGTGAAAAA
AAAAATTACTCATCCATTTGCCTCCCAGCCATTGGGACAGGAAATGCCAAACAACACCCA
GATAAGGTTGCTGAAGCCATAATTGATGCCATTGAAGACTTTGTCCAGAAAGGATCAGCC
CAGTCTGTGAAAAAAGTTAAAGTTGTTATCTTTCTGCCTCAAGTACTGGATGTGTTTTAT
GCCAACATGAAGAAAAGAGAAGGGACTCAGCTTTCTTCCCAACAGTCTGTGATGTCTAAA
CTTGCATCATTTTTGGGCTTTTCAAAGCAATCTCCCCAAAAAAAGAATCATTTGGTTTTG
GAAAAGAAAACAGAATCAGCAACTTTTCGGGTGTGTGGTGAAAATGTCACGTGTGTGGAA
TATGCTATCTCCTGGCTACAAGACCTGATTGAAAAAGAACAGTGTCCTTACACCAGTGAA
GATGAGTGCATCAAAGACTTTGATGAAAAGGAGTATCAGGAGTTGAATGAGCTGCAGAAG
AAGTTAAATATTAACATTTCCCTGGACCATAAGAGACCTTTGATTAAGGTTTTGGGAATT
AGCAGAGATGTGATGCAGGCTAGAGATGAAATTGAGGCGATGATCAAGAGAGTTCGATTG
GCCAAAGAACAGGAATCCCGGGCAGATTGTATCAGTGAGTTTATAGAATGGCAGTATAAT
GACAATAACACTTCTCATTGTTTTAACAAAATGACCAATCTGAAATTAGAGGATGCAAGG
AGAGAAAAGAAAAAAACAGTTGATGTCAAAATTAATCATCGGCACTACACAGTGAACTTG
AACACATACACTGCCACAGACACAAAGGGCCACAGTTTATCTGTTCAGCGCCTCACGAAA
TCCAAAGTTGACATCCCTGCACACTGGAGTGATATGAAGCAGCAGAATTTCTGTGTGGTG
GAGCTGCTGCCTAGTGATCCTGAGTACAACACGGTGGCAAGCAAGTTTAATCAGACCTGC
TCACACTTCAGAATAGAGAAGATTGAGAGGATCCAGAATCCAGATCTCTGGAATAGCTAC
CAGGCAAAGAAAAAAACTATGGATGCCAAGAATGGCCAGACAATGAATGAGAAGCAACTC
TTCCATGGGACAGATGCCGGCTCCGTGCCACACGTCAATCGAAATGGCTTTAACCGCAGC
TATGCCGGAAAGAATGCTGTGGCATATGGAAAGGGAACCTATTTTGCTGTCAATGCCAAT
TATTCTGCCAATGATACGTACTCCAGACCAGATGCAAATGGGAGAAAGCATGTGTATTAT
GTGCGAGTACTTACTGGAATCTATACACATGGAAATCATTCATTAATTGTGCCTCCTTCA
AAGAACCCTCAAAATCCTACTGACCTGTATGACACTGTCACAGATAATGTGCACCATCCA
AGTTTATTTGTGGCATTTTATGACTACCAAGCATACCCAGAGTACCTTATTACGTTTAGA
AAATAA
Protein Properties
Number of Residues 1720
Molecular Weight 202798.68
Theoretical pI 7.181
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Poly [ADP-ribose] polymerase 14
MAVPGSFPLLVEGSWGPDPPKNLNTKLQMYFQSPKRSGGGECEVRQDPRSPSRFLVFFYP
EDVRQKVLERKNHELVWQGKGTFKLTVQLPATPDEIDHVFEEELLTKESKTKEDVKEPDT
IRFVDDCTKHHSIKQLQLSPRLLEVTNTIRVENLPPGADDYSLKLFFENPYNGGGRVANV
EYFPEESSALIEFFDRKVLDTIMATKLDFNKMPLSVFPYYASLGTALYGKEKPLIKLPAP
FEESLDLPLWKFLQKKNHLIEEINDEMRRCHCELTWSQLSGKVTIRPAATLVNEGRPRIK
TWQADTSTTLSSIRSKYKVNPIKVDPTMWDTIKNDVKDDRILIEFDTLKEMVILAGKSED
VQSIEVQVRELIESTTQKIKREEQSLKEKMIISPGRYFLLCHSSLLDHLLTECPEIEICY
DRVTQHLCLKGPSADVYKAKCEIQEKVYTMAQKNIQVSPEIFQFLQQVNWKEFSKCLFIA
QKILALYELEGTTVLLTSCSSEALLEAEKQMLSALNYKRIEVENKEVLHGKKWKGLTHNL
LKKQNSSPNTVIINELTSETTAEVIITGCVKEVNETYKLLFNFVEQNMKIERLVEVKPSL
VIDYLKTEKKLFWPKIKKVNVQVSFNPENKQKGILLTGSKTEVLKAVDIVKQVWDSVCVK
SVHTDKPGAKQFFQDKARFYQSEIKRLFGCYIELQENEVMKEGGSPAGQKCFSRTVLAPG
VVLIVQQGDLARLPVDVVVNASNEDLKHYGGLAAALSKAAGPELQADCDQIVKREGRLLP
GNATISKAGKLPYHHVIHAVGPRWSGYEAPRCVYLLRRAVQLSLCLAEKYKYRSIAIPAI
SSGVFGFPLGRCVETIVSAIKENFQFKKDGHCLKEIYLVDVSEKTVEAFAEAVKTVFKAT
LPDTAAPPGLPPAAAGPGKTSWEKGSLVSPGGLQMLLVKEGVQNAKTDVVVNSVPLDLVL
SRGPLSKSLLEKAGPELQEELDTVGQGVAVSMGTVLKTSSWNLDCRYVLHVVAPEWRNGS
TSSLKIMEDIIRECMEITESLSLKSIAFPAIGTGNLGFPKNIFAELIISEVFKFSSKNQL
KTLQEVHFLLHPSDHENIQAFSDEFARRANGNLVSDKIPKAKDTQGFYGTVSSPDSGVYE
MKIGSIIFQVASGDITKEEADVIVNSTSNSFNLKAGVSKAILECAGQNVERECSQQAQQR
KNDYIITGGGFLRCKNIIHVIGGNDVKSSVSSVLQECEKKNYSSICLPAIGTGNAKQHPD
KVAEAIIDAIEDFVQKGSAQSVKKVKVVIFLPQVLDVFYANMKKREGTQLSSQQSVMSKL
ASFLGFSKQSPQKKNHLVLEKKTESATFRVCGENVTCVEYAISWLQDLIEKEQCPYTSED
ECIKDFDEKEYQELNELQKKLNINISLDHKRPLIKVLGISRDVMQARDEIEAMIKRVRLA
KEQESRADCISEFIEWQYNDNNTSHCFNKMTNLKLEDARREKKKTVDVKINHRHYTVNLN
TYTATDTKGHSLSVQRLTKSKVDIPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCS
HFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQLFHGTDAGSVPHVNRNGFNRSY
AGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGNHSLIVPPSK
NPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFRK
GenBank ID Protein 154813199
UniProtKB/Swiss-Prot ID Q460N5
UniProtKB/Swiss-Prot Entry Name PAR14_HUMAN
PDB IDs
GenBank Gene ID Not Available
GeneCard ID PARP14
GenAtlas ID PARP14
HGNC ID HGNC:29232
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Nagase T, Ishikawa K, Kikuno R, Hirosawa M, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Oct 29;6(5):337-45. [PubMed:10574462 ]
  3. Aguiar RC, Takeyama K, He C, Kreinbrink K, Shipp MA: B-aggressive lymphoma family proteins have unique domains that modulate transcription and exhibit poly(ADP-ribose) polymerase activity. J Biol Chem. 2005 Oct 7;280(40):33756-65. Epub 2005 Aug 1. [PubMed:16061477 ]