You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08872
Secondary Accession Numbers
  • 14599
Name Mono [ADP-ribose] polymerase PARP16
Synonyms
  1. PARP-16
  2. ADP-ribosyltransferase diphtheria toxin-like 15
  3. Poly [ADP-ribose] polymerase 16
  4. ARTD15
Gene Name PARP16
Protein Type Unknown
Biological Properties
General Function Involved in NAD+ ADP-ribosyltransferase activity
Specific Function Mono-ADP-ribosyltransferase targeting the karyopherin KPNB1. Plays a role in unfolded protein response (UPR), by ADP-ribosylating and activating EIF2AK3 and ERN1, two important UPR effectors.
Pathways Not Available
Reactions
NAD + protein-L-arginine → Niacinamide + N(omega)-(ADP-D-ribosyl)-protein-L-arginine details
GO Classification
Biological Process
response to unfolded protein
Cellular Component
endoplasmic reticulum membrane
nuclear membrane
integral to membrane
Function
catalytic activity
transferase activity
nad+ adp-ribosyltransferase activity
transferase activity, transferring pentosyl groups
transferase activity, transferring glycosyl groups
Molecular Function
NAD(P)+-protein-arginine ADP-ribosyltransferase activity
NAD+ ADP-ribosyltransferase activity
Cellular Location
  1. Membrane
  2. Single-pass membrane protein (Potential)
Gene Properties
Chromosome Location 15
Locus 15q22.31
SNPs PARP16
Gene Sequence
>969 bp
ATGCAGCCCTCAGGCTGGGCGGCCGCCAGGGAGGCGGCGGGCCGCGACATGCTGGCCGCC
GACCTCCGGTGCAGCCTCTTCGCCTCGGCCCTGCAGAGCTACAAGCGCGACTCGGTGCTG
CGGCCCTTCCCCGCGTCCTACGCCCGCGGCGACTGTAAGGACTTTGAAGCCCTGCTTGCA
GATGCCAGCAAGTTACCTAACCTGAAAGAACTTCTCCAGTCCTCCGGAGACAACCACAAA
CGGGCCTGGGACCTGGTGAGCTGGATTTTATCCTCAAAGGTCCTGACAATCCACAGTGCA
GGGAAGGCAGAGTTTGAAAAGATCCAAAAGCTGACTGGGGCTCCTCACACGCCTGTTCCT
GCACCGGACTTCCTGTTTGAAATTGAGTACTTTGACCCAGCCAACGCCAAATTTTATGAG
ACCAAAGGAGAACGAGACCTAATCTATGCATTTCATGGTAGCCGCCTAGAAAACTTCCAT
TCCATTATCCACAATGGCCTGCACTGCCATCTGAACAAGACATCCTTGTTCGGAGAGGGG
ACCTACCTCACCAGTGACTTAAGCCTGGCCCTCATATACAGCCCCCATGGCCATGGGTGG
CAGCACAGCCTCCTCGGCCCCATCCTTAGCTGTGTGGCCGTGTGTGAGGTCATTGACCAT
CCGGACGTCAAGTGCCAAACCAAGAAGAAGGATTCCAAGGAGATAGATCGCAGACGAGCG
AGAATCAAACATAGTGAAGGGGGAGACATCCCTCCCAAGTACTTCGTGGTCACCAATAAC
CAGCTGCTGCGAGTGAAGTACCTCCTGGTGTATTCACAGAAGCCACCCAAGAGGGCTCCG
AGCCAGCTCTCCTGGTTTTCCAGCCATTGGTTTACCGTCATGATATCCCTGTATCTGCTG
CTGCTGCTCATAGTGAGTGTCATCAACTCCTCTGCTTTCCAACACTTTTGGAATCGTGCG
AAAAGATAA
Protein Properties
Number of Residues 322
Molecular Weight 36469.41
Theoretical pI 9.049
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Poly [ADP-ribose] polymerase 16
MQPSGWAAAREAAGRDMLAADLRCSLFASALQSYKRDSVLRPFPASYARGDCKDFEALLA
DASKLPNLKELLQSSGDNHKRAWDLVSWILSSKVLTIHSAGKAEFEKIQKLTGAPHTPVP
APDFLFEIEYFDPANAKFYETKGERDLIYAFHGSRLENFHSIIHNGLHCHLNKTSLFGEG
TYLTSDLSLALIYSPHGHGWQHSLLGPILSCVAVCEVIDHPDVKCQTKKKDSKEIDRRRA
RIKHSEGGDIPPKYFVVTNNQLLRVKYLLVYSQKPPKRASSQLSWFSSHWFTVMISLYLL
LLLIVSVINSSAFQHFWNRAKR
GenBank ID Protein 21411003
UniProtKB/Swiss-Prot ID Q8N5Y8
UniProtKB/Swiss-Prot Entry Name PAR16_HUMAN
PDB IDs
GenBank Gene ID BC031074
GeneCard ID PARP16
GenAtlas ID PARP16
HGNC ID HGNC:26040
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]