You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08874
Secondary Accession Numbers
  • 14601
Name Poly [ADP-ribose] polymerase 8
Synonyms
  1. PARP-8
  2. ADP-ribosyltransferase diphtheria toxin-like 16
  3. ARTD16
Gene Name PARP8
Protein Type Unknown
Biological Properties
General Function Involved in NAD+ ADP-ribosyltransferase activity
Specific Function Not Available
Pathways Not Available
Reactions
NAD + (ADP-D-ribosyl)(n)-acceptor → Niacinamide + (ADP-D-ribosyl)(n+1)-acceptor details
GO Classification
Cellular Component
intracellular
Function
catalytic activity
transferase activity
nad+ adp-ribosyltransferase activity
transferase activity, transferring pentosyl groups
transferase activity, transferring glycosyl groups
Molecular Function
NAD+ ADP-ribosyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus 5q11.1
SNPs PARP8
Gene Sequence
>2565 bp
ATGGGGATGTGTTCAAGGCAAGAGCGAATTCAGAAGGATATCGACGTCGTGATCCAGAAG
TCCAGAGCTGAGAAGGACTGCCTGTTTGCAGATTTCAGATACTCTGACTCCACCTTTACT
TTTACCTACGTTGGCGGCCCCAGAAGTGTATCCTACTCAGTACATGTATCTGAAGATTAC
CCAGATAATACATATGTGTCAAGTTCAGAGAATGATGAAGATGTGCTAGTTACTACAGAG
CCAATACCAGTAATTTTTCATAGAATAGCAACAGAATTAAGAAAAACAAATGACATTAAC
TGTTGCTTATCCATAAAATCCAAATTACAAAAGGAAAATGGGGAGGAATCAAGACAGAAT
AGTACAGTGGAGGAAGATTCTGAAGGTGACAATGATTCCGAAGAATTTTATTACGGAGGG
CAGGTGAACTATGATGGGGAACTGCACAAGCACCCACAACTGGAAGCTGATTTGTCAGCA
GTTAGAGAGATATATGGGCCACATGCAGTTTCTCTCAGGGAATATGGAGCCATTGATGAT
GTAGATATTGATCTGCATATCGATGTTAGCTTTCTTGATGAGGAGATTGCTGTGGCTTGG
GAAGTAATTCGAACAGAACCTATAATTGTTCGACTACACTGTTCACTTACACAGTATTTA
AATGGCCCAGTGCCCACTGTTGATGTCTTTCAGATTTCCACAAAAGAGCGATTTGGATTG
GGACATCAGCTGAAAAAAATCATGCAGACATTTGTTACACAGCAGTGGAAACAGAGCAAA
GAAAAATCCAATTGCCTGCACAATAAAAAGTTGTCAGAGAAGAAAGTGAAGTCTCCCCTG
CATTTATTTTCTACTTTGCGCAGGTCGCCAAGTTATCCTCCCCCTGGTTGTGGCAAAAGC
AAATCCAAACTGAAATCTGAGCAGGACGGAATCTCCAAAACGCATAAGCTGCTGCGGAGG
ACTTGTTCCAGCACAGTCAAGACTGATGATGTGTGTGTCACAAAGTCACACAGGACCTTT
GGCCGCTCCTTGTCCAGCGATCCCAGGGCGGAGCAGGCTATGACAGCAATTAAATCGCAC
AAACTTTTGAACCGTCCTTGCCCTGCAGCTGTTAAGTCAGAGGAATGCCTAACTCTAAAG
TCGCATAGACTATTGACTCGATCTTGTTCTGGAGATCCACGATGTGAGCACAACACAAAC
TTGAAGCCCCATAAACTGTTAAGCAGGTCTTACTCTAGTAATCTCAGAATGGAAGAATTA
TATGGACTGAAAAATCACAAATTGCTCAGCAAGTCCTACTCCAGTGCCCCCAAGTCATCC
AAAACTGAGCTTTTCAAGGAACCTAACGCAGAGGGCAGGAGGCTCTCTCTTACCTCAGGG
CTTATTGGTATCCTAACACCATCTTCATCTTCATCTTCTCAGCTTGCTCCAAATGGTGCA
AAATGCATTCCAGTACGAGACCGTGGCTTCCTGGTGCAGACAATTGAGTTTGCTGAACAG
CGGATCCCTGTATTAAATGAATATTGTGTGGTTTGTGATGAGCCACATGTGTTTCAAAAT
GGCCCTATGCTTAGGCCTACCGTATGTGAACGGGAGCTGTGTGTGTTTGCTTTTCAAACC
CTGGGAGTAATGAATGAAGCTGCTGATGAAATAGCAACTGGAGCTCAGGTGGTAGATCTA
CTAGTATCCATGTGTAGGTCTGCGTTGGAATCTCCTAGAAAAGTTGTGATTTTCGAGCCA
TATCCTTCTGTGGTAGATCCTAATGATCCTCAGATGTTGGCCTTCAACCCCAGGAAAAAG
AACTATGATCGAGTAATGAAAGCACTGGATAGCATAACTTCTATCAGAGAAATGACACAA
GCACCATATCTGGAAATCAAGAAGCAAATGGATAAACAGGACCCCCTTGCTCATCCCTTA
CTGCAATGGGTTATATCAAGTAATAGATCACATATTGTGAAACTGCCAGTTAACAGGCAA
TTGAAGTTTATGCATACTCCACATCAGTTCCTTCTTCTCAGCAGTCCACCAGCCAAAGAA
TCCAATTTTAGAGCTGCTAAAAAACTCTTTGGAAGCACCTTTGCATTTCATGGCTCACAC
ATTGAAAACTGGCACTCCATCCTGAGGAATGGTCTGGTTGTTGCTTCTAATACACGATTG
CAGCTCCATGGTGCAATGTATGGAAGTGGAATCTATCTTAGTCCAATGTCAAGCATATCA
TTTGGTTACTCAGGGATGAACAAGAAACAGAAGGTGTCAGCCAAGGACGAGCCAGCTTCA
AGCAGTAAAAGCAGCAATACATCACAGTCACAGAAAAAAGGACAGCAATCCCAATTCCTG
CAAAGCCGTAACTTAAAATGCATAGCCTTATGTGAAGTGATCACCTCATCTGACCTGCAC
AAACATGGAGAGATATGGGTTGTCCCCAATACTGACCATGTCTGCACACGATTCTTTTTC
GTCTATGAAGACGGCCAAGTGGGAGATGCAAATATTAATACACAAGAAGGAGGCATTCAC
AAAGAGATCCTCCGAGTAATTGGTAATCAAACTGCTACTGGTTAA
Protein Properties
Number of Residues 854
Molecular Weight 95870.105
Theoretical pI 8.279
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Poly [ADP-ribose] polymerase 8
MGMCSRQERIQKDIDVVIQKSRAEKDCLFADFRYSDSTFTFTYVGGPRSVSYSVHVSEDY
PDNTYVSSSENDEDVLVTTEPIPVIFHRIATELRKTNDINCCLSIKSKLQKENGEESRQN
STVEEDSEGDNDSEEFYYGGQVNYDGELHKHPQLEADLSAVREIYGPHAVSLREYGAIDD
VDIDLHIDVSFLDEEIAVAWEVIRTEPIIVRLHCSLTQYLNGPVPTVDVFQISTKERFGL
GHQLKKIMQTFVTQQWKQSKEKSNCLHNKKLSEKKVKSPLHLFSTLRRSPSYPPPGCGKS
KSKLKSEQDGISKTHKLLRRTCSSTVKTDDVCVTKSHRTFGRSLSSDPRAEQAMTAIKSH
KLLNRPCPAAVKSEECLTLKSHRLLTRSCSGDPRCEHNTNLKPHKLLSRSYSSNLRMEEL
YGLKNHKLLSKSYSSAPKSSKTELFKEPNAEGRRLSLTSGLIGILTPSSSSSSQLAPNGA
KCIPVRDRGFLVQTIEFAEQRIPVLNEYCVVCDEPHVFQNGPMLRPTVCERELCVFAFQT
LGVMNEAADEIATGAQVVDLLVSMCRSALESPRKVVIFEPYPSVVDPNDPQMLAFNPRKK
NYDRVMKALDSITSIREMTQAPYLEIKKQMDKQDPLAHPLLQWVISSNRSHIVKLPVNRQ
LKFMHTPHQFLLLSSPPAKESNFRAAKKLFGSTFAFHGSHIENWHSILRNGLVVASNTRL
QLHGAMYGSGIYLSPMSSISFGYSGMNKKQKVSAKDEPASSSKSSNTSQSQKKGQQSQFL
QSRNLKCIALCEVITSSDLHKHGEIWVVPNTDHVCTRFFFVYEDGQVGDANINTQEGGIH
KEILRVIGNQTATG
GenBank ID Protein 295844829
UniProtKB/Swiss-Prot ID Q8N3A8
UniProtKB/Swiss-Prot Entry Name PARP8_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001178055.1
GeneCard ID PARP8
GenAtlas ID PARP8
HGNC ID HGNC:26124
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]