You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08887
Secondary Accession Numbers
  • 14615
Name Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial
Synonyms
  1. Protein SITPEC
Gene Name ECSIT
Protein Type Enzyme
Biological Properties
General Function Involved in oxidoreductase activity, acting on NADH or
Specific Function Adapter protein of the Toll-like and IL-1 receptor signaling pathway that is involved in the activation of NF-kappa-B via MAP3K1. Promotes proteolytic activation of MAP3K1. Involved in the BMP signaling pathway. Required for normal embryonic development. Required for efficient assembly of mitochondrial NADH:ubiquinone oxidoreductase
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. Mitochondrion
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.2
SNPs ECSIT
Gene Sequence
>1296 bp
ATGAGCTGGGTCCAGGCCACCCTACTGGCCCGAGGCCTCTGTAGGGCCTGGGGAGGCACC
TGCGGGGCCGCCCTCACAGGAACCTCCATCTCTCAGGTCCCTCGCCGGCTCCCTCGGGGC
CTCCACTGCAGCGCAGCTGCCCATAGCTCTGAACAGTCCCTGGTTCCCAGCCCACCGGAA
CCCCGGCAGAGGCCCACCAAGGCTCTGGTGCCCTTTGAGGACCTGTTTGGGCAGGCGCCT
GGTGGGGAACGGGACAAGGCGAGCTTCCTGCAGACGGTGCAGAAATTTGCGGAGCACAGC
GTGCGTAAGCGGGGCCACATTGACTTCATCTACCTGGCCCTGCGCAAGATGCGGGAGTAT
GGTGTCGAGCGGGACCTGGCTGTGTACAACCAGCTGCTCAACATCTTCCCCAAGGAGGTC
TTCCGGCCTCGCAACATCATCCAGCGCATCTTCGTCCACTACCCTCGGCAGCAGGAGTGT
GGGATTGCTGTCCTGGAGCAGATGGAGAACCACGGTGTGATGCCCAACAAGGAGACGGAG
TTCCTGCTGATTCAGATCTTTGGACGCAAAAGCTACCCCATGCTCAAGTTGGTGCGCCTG
AAGCTGTGGTTCCCTCGATTCATGAACGTCAACCCCTTCCCAGTGCCCCGGGACCTGCCC
CAGGACCCTGTGGAGCTGGCCATGTTTGGCCTGCGGCACATGGAGCCTGACCTTAGTGCC
AGGGTCACCATCTACCAGGTTCCTTTGCCCAAAGACTCAACAGGTGCAGCAGATCCCCCC
CAGCCCCACATCGTAGGAATCCAGAGTCCCGATCAGCAGGCCGCCCTGGCCTGCCACAAT
CCAGCCCGGCCTGTCTTTGTTGAGGGCCCCTTCTCCCTGTGGCTCCGCAACAAGTGTGTG
TATTACCACATCCTCAGAGCTGACTTGCTGCCCCCGGAGGAGAGGGAAGTGGAAGAGACG
CCGGAGGAGTGGAACCTCTACTACCCGATGCAGCTGGACCTGGAGTATGTGAGGAGTGGC
TGGGACAACTACGAGTTTGACATCAATGAAGTGGAGGAAGGCCCTGTCTTCGCCATGTGC
ATGGCGGGTGCTCATGACCAGGCGACGATGGCTAAGTGGATCCAGGGCCTGCAGGAGACC
AACCCAACCCTGGCCCAGATCCCCGTGGTCTTCCGCCTCGCCGGGTCCACCCGGGAGCTC
CAGACATCCTCTGCAGGGCTGGAGGAGCCGCCCCTGCCCGAGGACCACCAGGAAGAAGAC
GACAACCTGCAGCGACAGCAGCAGGGCCAGAGCTAG
Protein Properties
Number of Residues 431
Molecular Weight 49147.8
Theoretical pI 6.25
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial
MSWVQATLLARGLCRAWGGTCGAALTGTSISQVPRRLPRGLHCSAAAHSSEQSLVPSPPE
PRQRPTKALVPFEDLFGQAPGGERDKASFLQTVQKFAEHSVRKRGHIDFIYLALRKMREY
GVERDLAVYNQLLNIFPKEVFRPRNIIQRIFVHYPRQQECGIAVLEQMENHGVMPNKETE
FLLIQIFGRKSYPMLKLVRLKLWFPRFMNVNPFPVPRDLPQDPVELAMFGLRHMEPDLSA
RVTIYQVPLPKDSTGAADPPQPHIVGIQSPDQQAALARHNPARPVFVEGPFSLWLRNKCV
YYHILRADLLPPEEREVEETPEEWNLYYPMQLDLEYVRSGWDNYEFDINEVEEGPVFAMC
MAGAHDQATMAKWIQGLQETNPTLAQIPVVFRLAGSTRELQTSSAGLEEPPLPEDHQEED
DNLQRQQQGQS
GenBank ID Protein 7407498
UniProtKB/Swiss-Prot ID Q9BQ95
UniProtKB/Swiss-Prot Entry Name ECSIT_HUMAN
PDB IDs Not Available
GenBank Gene ID AF243044
GeneCard ID ECSIT
GenAtlas ID ECSIT
HGNC ID HGNC:29548
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Vogel RO, Janssen RJ, van den Brand MA, Dieteren CE, Verkaart S, Koopman WJ, Willems PH, Pluk W, van den Heuvel LP, Smeitink JA, Nijtmans LG: Cytosolic signaling protein Ecsit also localizes to mitochondria where it interacts with chaperone NDUFAF1 and functions in complex I assembly. Genes Dev. 2007 Mar 1;21(5):615-24. [PubMed:17344420 ]