You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08892
Secondary Accession Numbers
  • 14620
Name Short-chain dehydrogenase/reductase 3
Synonyms
  1. DD83.1
  2. Retinal short-chain dehydrogenase/reductase 1
  3. retSDR1
Gene Name DHRS3
Protein Type Enzyme
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Catalyzes the reduction of all-trans-retinal to all-trans-retinol in the presence of NADPH.
Pathways
  • Retinol metabolism
  • Retinol Metabolism
  • Vitamin A Deficiency
Reactions
Vitamin A + NADP → Retinal + NADPH details
GO Classification
Biological Process
retinol metabolic process
visual perception
Cellular Component
integral to membrane
Function
binding
catalytic activity
oxidoreductase activity
Molecular Function
electron carrier activity
NADP-retinol dehydrogenase activity
nucleotide binding
Process
metabolic process
oxidation reduction
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location 1
Locus 1p36.1
SNPs DHRS3
Gene Sequence
>909 bp
ATGGCGTGGAAACGGCTGGGCGCGCTGGTGATGTTCCCTCTACAGATGATCTATCTGGTG
GTGAAAGCAGCCGTCGGACTGGTGCTGCCCGCCAAGCTGCGGGACCTGTCGCGGGAGAAC
GTCCTCATCACCGGCGGCGGGAGAGGCATCGGGCGTCAGCTCGCCCGCGAGTTCGCGGAG
CGCGGCGCCAGAAAGATTGTTCTCTGGGGCCGGACTGAGAAATGCCTGAAGGAGACGACG
GAGGAGATCCGGCAGATGGGCACTGAGTGCCATTACTTCATCTGTGATGTGGGCAACCGG
GAGGAGGTGTACCAGACGGCCAAGGCCGTCCGGGAGAAGGTGGGTGACATCACCATCCTG
GTGAACAATGCCGCCGTGGTCCATGGGAAGAGCCTAATGGACAGTGATGATGATGCCCTC
CTCAAGTCCCAACACATCAACACCCTGGGCCAGTTCTGGACCACCAAGGCCTTCCTGCCG
CGTATGCTGGAGCTGCAGAATGGCCACATCGTGTGCCTCAACTCCGTGCTGGCACTGTCT
GCCATCCCCGGTGCCATCGACTACTGCACATCCAAAGCGTCAGCCTTCGCCTTCATGGAG
AGCCTGACCCTGGGGCTGCTGGACTGTCCGGGAGTCAGCGCCACCACAGTGCTGCCCTTC
CACACCAGCACCGAGATGTTCCAGGGCATGAGAGTCAGGTTTCCCAACCTCTTTCCCCCA
CTGAAGCCGGAGACGGTGGCCCGGAGGACAGTGGAAGCTGTGCAGCTCAACCAGGCCCTC
CTCCTCCTCCCATGGACAATGCATGCCCTCGTTATCTTGAAAAGCATACTTCCACAGGCT
GCACTCGAGGAGATCCACAAATTCTCAGGAACCTACACCTGCATGAACACTTTCAAAGGG
CGGACATAG
Protein Properties
Number of Residues 302
Molecular Weight 33548.115
Theoretical pI 8.838
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Short-chain dehydrogenase/reductase 3
MVWKRLGALVMFPLQMIYLVVKAAVGLVLPAKLRDLSRENVLITGGGRGIGRQLAREFAE
RGARKIVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITIL
VNNAAVVHGKSLMDSDDDALLKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALS
AIPGAIDYCTSKASAFAFMESLTLGLLDCPGVSATTVLPFHTSTEMFQGMRVRFPNLFPP
LKPETVARRTVEAVQLNQALLLLPWTMHALVILKSILPQAALEEIHKFSGTYTCMNTFKG
RT
GenBank ID Protein 3450828
UniProtKB/Swiss-Prot ID O75911
UniProtKB/Swiss-Prot Entry Name DHRS3_HUMAN
PDB IDs Not Available
GenBank Gene ID AF061741
GeneCard ID DHRS3
GenAtlas ID DHRS3
HGNC ID HGNC:17693
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed:12975309 ]
  5. Haeseleer F, Huang J, Lebioda L, Saari JC, Palczewski K: Molecular characterization of a novel short-chain dehydrogenase/reductase that reduces all-trans-retinal. J Biol Chem. 1998 Aug 21;273(34):21790-9. [PubMed:9705317 ]
  6. Cerignoli F, Guo X, Cardinali B, Rinaldi C, Casaletto J, Frati L, Screpanti I, Gudas LJ, Gulino A, Thiele CJ, Giannini G: retSDR1, a short-chain retinol dehydrogenase/reductase, is retinoic acid-inducible and frequently deleted in human neuroblastoma cell lines. Cancer Res. 2002 Feb 15;62(4):1196-204. [PubMed:11861404 ]