Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08897
Secondary Accession Numbers
  • 14626
Name Putative tyrosine-protein phosphatase auxilin
Synonyms
  1. DnaJ homolog subfamily C member 6
Gene Name DNAJC6
Protein Type Enzyme
Biological Properties
General Function Involved in heat shock protein binding
Specific Function Recruits HSPA8/HSC70 to clathrin-coated vesicles and promotes uncoating of clathrin-coated vesicles (By similarity).
Pathways
  • Endocytosis
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphate details
GO Classification
Biological Process
cellular membrane organization
peptidyl-tyrosine dephosphorylation
post-Golgi vesicle-mediated transport
Cellular Component
cytosol
Function
binding
protein binding
heat shock protein binding
Molecular Function
protein tyrosine phosphatase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1p31.3
SNPs DNAJC6
Gene Sequence
>2742 bp
ATGAAAGATTCTGAAAATAAAGGTGCCTCATCTCCAGACATGGAGCCCAGCTATGGGGGA
GGTCTCTTTGACATGGTAAAAGGAGGTGCAGGGAGGCTCTTTAGTAACCTAAAGGACAAC
TTGAAAGACACCCTCAAAGACACATCTTCTAGAGTGATACAATCTGTGACCAGCTACACA
AAGGGAGATTTAGACTTCACTTATGTTACCTCCAGAATTATTGTGATGTCCTTTCCTCTG
GACAATGTTGACATAGGATTCAGGAATCAGGTTGATGACATTCGAAGCTTTTTGGATTCC
AGACATCTTGACCACTACACAGTATACAATCTGTCACCTAAGTCTTATCGAACTGCCAAG
TTTCACAGCCGGGTCTCAGAATGCAGTTGGCCCATTAGGCAGGCTCCCAGTCTGCACAAC
CTTTTTGCTGTGTGTCGGAATATGTATAACTGGCTACTGCAGAATCCCAAAAATGTCTGT
GTTGTCCACTGCTTGGATGGACGGGCGGCATCATCAATTCTGGTTGGTGCTATGTTCATT
TTCTGTAATCTCTACTCTACTCCTGGCCCAGCCATTCGATTGCTATATGCAAAGCGACCA
GGAATTGGACTTTCACCATCCCATAGGAGATACCTGGGCTATATGTGTGACCTACTGGCA
GACAAGCCCTACCGCCCTCACTTCAAGCCTCTCACAATTAAGTCGATCACTGTCAGTCCA
ATACCCTTTTTCAACAAACAGAGGAATGGATGTCGCCCTTACTGTGATGTACTCATTGGA
GAAACCAAAATATATTCGACTTGCACAGATTTTGAACGAATGAAAGAATATCGTGTCCAA
GATGGAAAAATCTTCATTCCCTTGAACATCACTGTGCAAGGAGACGTGGTTGTTTCCATG
TATCACTTGAGGTCAACCATTGGGAGCCGGCTACAGGCTAAGGTGACCAACACACAGATA
TTCCAGCTTCAGTTTCACACTGGATTCATACCACTGGACACAACAGTTTTAAAGTTCACC
AAGCCTGAGTTAGATGCATGTGATGTACCAGAAAAATATCCTCAGCTATTTCAGGTGACA
CTGGATGTAGAACTACAGCCCCATGACAAAGTAATAGACTTAACTCCACCATGGGAACAT
TACTGCACAAAAGATGTCAATCCCAGCATCCTCTTCTCTTCTCACCAGGAACATCAAGAT
ACGCTGGCCTTAGGAGGACAGGCTCCAATAGATATCCCTCCAGACAACCCCAGGCATTAC
GGACAAAGTGGTTTCTTTGCCTCTCTCTGTTGGCAAGATCAGAAATCGGAGAAGTCATTC
TGTGAGGAGGACCACGCTGCCCTAGTGAATCAGGAAAGTGAGCAATCAGATGATGAACTT
CTGACACTTTCCAGTCCGCATGGCAATGCCAATGGTGACAAGCCTCATGGAGTCAAGAAG
CCCAGCAAAAAGCAGCAGGAGCCAGCAGCCCCTCCACCCCCTGAGGATGTGGACCTTTTG
GGCCTGGAAGGGTCTGCAATGAGTAACAGCTTCTCTCCGCCAGCGGCTCCTCCCACCAAT
TCTGAACTACTGAGTGACCTGTTTGGGGGTGGAGGTGCAGCTGGTCCCACCCAGGCTGGA
CAGTCAGGAGTGGAAGATGTGTTTCATCCTAGTGGACCTGCGTCTACCCAGTCAACACCA
CGCCGCTCTGCCACCTCCACCTCTGCGTCTCCAACCCTAAGAGTGGGAGAAGGTGCCACC
TTTGACCCATTTGGAGCACCTTCTAAACCATCAGGTCAGGATTTGCTGGGTTCTTTTCTG
AACACATCCAGTGCTTCCAGTGACCCCTTTCTCCAGCCAACAAGAAGTCCTTCGCCCACA
GTACATGCTTCTAGTACGCCTGCTGTGAACATTCAGCCAGATGTTTCTGGAGGTTGGGAC
TGGCATGCTAAACCAGGAGGCTTTGGAATGGGAAGCAAGTCAGCTGCCACCAGCCCAACC
GGATCCTCGCATGGTACTCCCACCCATCAAAGCAAACCCCAGACTCTGGATCCTTTTGCC
GACCTTGGGACACTAGGTAGTTCTTCCTTTGCCAGCAAACCCACCACACCAACTGGATTG
GGTGGAGGATTCCCGCCTCTCAGCTCGCCACAGAAGGCGTCTCCCCAGCCTATGGGTGGC
GGGTGGCAGCAGGGAGGTGCCTACAACTGGCAGCAGCCACAGCCTAAGCCTCAGCCCAGC
ATGCCCCACTCCTCTCCCCAGAACCGACCCAACTACAACGTGAGCTTCTCAGCCATGCCT
GGGGGCCAGAACGAACGTGGGAAAGGATCAAGTAATTTGGAAGGGAAACAAAAAGCAGCT
GATTTTGAAGACCTACTCTCTGGTCAAGGTTTCAATGCTCACAAAGACAAAAAGGGGCCT
CGGACAATAGCTGAGATGAGAAAGGAGGAAATGGCCAAGGAAATGGATCCTGAGAAATTA
AAGATTCTGGAATGGATTGAAGGCAAAGAAAGAAATATCAGAGCCCTTCTTTCCACGATG
CATACCGTACTATGGGCTGGGGAGACCAAGTGGAAACCAGTTGGCATGGCAGACCTGGTA
ACACCAGAGCAGGTGAAGAAGGTGTACAGGAAGGCTGTCCTGGTGGTGCACCCAGATAAA
GCTACTGGGCAACCCTATGAACAATACGCAAAGATGATTTTCATGGAGCTCAATGATGCC
TGGTCTGAATTTGAAAACCAAGGCCAAAAGCCCTTATATTAA
Protein Properties
Number of Residues 913
Molecular Weight 105673.905
Theoretical pI 7.471
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Putative tyrosine-protein phosphatase auxilin
MKDSENKGASSPDMEPSYGGGLFDMVKGGAGRLFSNLKDNLKDTLKDTSSRVIQSVTSYT
KGDLDFTYVTSRIIVMSFPLDNVDIGFRNQVDDIRSFLDSRHLDHYTVYNLSPKSYRTAK
FHSRVSECSWPIRQAPSLHNLFAVCRNMYNWLLQNPKNVCVVHCLDGRAASSILVGAMFI
FCNLYSTPGPAIRLLYAKRPGIGLSPSHRRYLGYMCDLLADKPYRPHFKPLTIKSITVSP
IPFFNKQRNGCRPYCDVLIGETKIYSTCTDFERMKEYRVQDGKIFIPLNITVQGDVVVSM
YHLRSTIGSRLQAKVTNTQIFQLQFHTGFIPLDTTVLKFTKPELDACDVPEKYPQLFQVT
LDVELQPHDKVIDLTPPWEHYCTKDVNPSILFSSHQEHQDTLALGGQAPIDIPPDNPRHY
GQSGFFASLCWQDQKSEKSFCEEDHAALVNQESEQSDDELLTLSSPHGNANGDKPHGVKK
PSKKQQEPAAPPPPEDVDLLGLEGSAMSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAG
QSGVEDVFHPSGPASTQSTPRRSATSTSASPTLRVGEGATFDPFGAPSKPSGQDLLGSFL
NTSSASSDPFLQPTRSPSPTVHASSTPAVNIQPDVSGGWDWHAKPGGFGMGSKSAATSPT
GSSHGTPTHQSKPQTLDPFADLGTLGSSSFASKPTTPTGLGGGFPPLSSPQKASPQPMGG
GWQQGGAYNWQQPQPKPQPSMPHSSPQNRPNYNVSFSAMPGGQNERGKGSSNLEGKQKAA
DFEDLLSGQGFNAHKDKKGPRTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRALLSTM
HTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDA
WSEFENQGQKPLY
GenBank ID Protein 7662146
UniProtKB/Swiss-Prot ID O75061
UniProtKB/Swiss-Prot Entry Name AUXI_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_014787.2
GeneCard ID DNAJC6
GenAtlas ID DNAJC6
HGNC ID HGNC:15469
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Seki N, Ohira M, Nagase T, Ishikawa K, Miyajima N, Nakajima D, Nomura N, Ohara O: Characterization of cDNA clones in size-fractionated cDNA libraries from human brain. DNA Res. 1997 Oct 31;4(5):345-9. [PubMed:9455484 ]