You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08898
Secondary Accession Numbers
  • 14627
Name Dual specificity protein phosphatase CDC14A
Synonyms
  1. CDC14 cell division cycle 14 homolog A
Gene Name CDC14A
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatase activity
Specific Function Dual-specificity phosphatase. Required for centrosome separation and productive cytokinesis during cell division. May dephosphorylate the APC subunit FZR1/CDH1, thereby promoting APC-FZR1 dependent degradation of mitotic cyclins and subsequent exit from mitosis.
Pathways
  • Cell cycle
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphate details
A phosphoprotein + Water → a protein + Phosphate details
GO Classification
Biological Process
cell cycle
cell division
cell proliferation
peptidyl-tyrosine dephosphorylation
Cellular Component
centrosome
spindle
cytoplasm
nucleus
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
protein tyrosine/serine/threonine phosphatase activity
Molecular Function
phosphoprotein phosphatase activity
protein tyrosine/serine/threonine phosphatase activity
protein tyrosine phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. Cytoplasm
  4. cytoskeleton
  5. cytoskeleton
  6. spindle
  7. centrosome
Gene Properties
Chromosome Location 1
Locus 1p21
SNPs CDC14A
Gene Sequence
>1785 bp
ATGGCAGCGGAGTCAGGGGAACTAATCGGGGCTTGTGAGTTCATGAAAGATCGGTTATAT
TTTGCTACTTTAAGGAATAGACCAAAAAGCACAGTAAATACCCACTATTTCTCCATCGAT
GAGGAGCTGGTCTATGAAAATTTCTATGCAGATTTTGGACCGCTGAACTTGGCAATGGTG
TACAGATATTGCTGCAAACTAAACAAGAAACTAAAATCATACAGTTTGTCAAGAAAGAAA
ATAGTGCACTACACCTGTTTTGACCAACGGAAAAGAGCAAATGCAGCATTTTTGATAGGT
GCCTATGCAGTAATCTATTTAAAGAAGACACCAGAAGAAGCCTACAGAGCACTCCTGTCT
GGCTCAAACCCCCCCTATCTTCCATTCAGGGATGCTTCCTTTGGAAATTGCACTTACAAT
CTCACCATTCTCGACTGTTTGCAGGGAATCAGAAAGGGATTACAACATGGATTTTTTGAC
TTTGAGACATTTGATGTGGATGAATATGAACATTATGAGCGAGTTGAAAATGGTGACTTC
AACTGGATTGTTCCAGGAAAATTTTTAGCATTTAGTGGACCACATCCTAAAAGCAAAATT
GAGAATGGTTATCCTCTTCACGCCCCTGAAGCCTACTTTCCTTATTTCAAAAAGCATAAT
GTGACTGCAGTTGTGAGGCTAAACAAAAAGATTTATGAGGCAAAGCGCTTCACAGACGCT
GGCTTCGAGCACTATGACCTCTTCTTCATAGATGGCAGCACACCCAGTGACAACATCGTG
CGAAGGTTCCTGAACATCTGTGAGAACACCGAAGGGGCCATCGCCGTTCACTGCAAAGCT
GGTCTTGGAAGAACAGGGACATTGATAGCCTGTTATGTAATGAAACACTACAGGTTTACA
CATGCTGAAATAATTGCTTGGATTAGAATATGCCGGCCAGGCTCTATTATAGGACCCCAG
CAGCACTTCCTGGAAGAAAAACAAGCATCGTTGTGGGTCCAAGGAGACATTTTCCGATCC
AAACTGAAAAATCGACCATCCAGTGAAGGAAGTATTAATAAAATTCTTTCTGGCCTAGAT
GATATGTCTATTGGTGGAAATCTTTCAAAAACACAAAACATGGAACGATTTGGAGAGGAT
AACTTAGAAGATGATGATGTGGAAATGAAAAATGGTATAACCCAGGGAGACAAACTACGT
GCCTTAAAAAGTCAGAGACAGCCACGTACCTCACCATCCTGTGCATTTAGGTCAGATGAT
ACAAAAGGACATCCAAGAGCAGTGTCCCAGCCTTTCAGATTAAGTTCATCCCTGCAAGGA
TCTGCAGTTACTTTGAAGACATCAAAAATGGCACTGTCCCCTTCAGCAACGGCCAAGAGG
ATCAACAGAACTTCTTTGTCTTCGGGTGCCACTGTAAGAAGCTTTTCCATAAACTCCCGG
CTAGCCAGTTCTCTAGGGAACTTGAATGCTGCAACAGATGATCCAGAGAACAAAAAGACC
TCCTCATCCTCTAAGGCAGGCTTCACAGCCAGCCCGTTTACCAACCTCTTGAATGGCAGC
TCCCAGCCAACTACCAGAAATTACCCTGAGCTCAACAATAATCAGTACAACAGAAGCAGC
AACAGCAACGGGGGCAACCTGAACAGCCCCCCAGGCCCCCACAGCGCCAAGACAGAGGAG
CACACCACCATCCTCCGACCCTCCTACACCGGGCTTTCTTCTTCTTCAGCGAGATTCCTG
AGCCGTTCTATCCCTTCCCTTCAGTCTGAATATGTTCATTACTAA
Protein Properties
Number of Residues 594
Molecular Weight 66573.305
Theoretical pI 9.1
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Dual specificity protein phosphatase CDC14A
MAAESGELIGACEFMKDRLYFATLRNRPKSTVNTHYFSIDEELVYENFYADFGPLNLAMV
YRYCCKLNKKLKSYSLSRKKIVHYTCFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLS
GSNPPYLPFRDASFGNCTYNLTILDCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDF
NWIVPGKFLAFSGPHPKSKIENGYPLHAPEAYFPYFKKHNVTAVVRLNKKIYEAKRFTDA
GFEHYDLFFIDGSTPSDNIVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFT
HAEIIAWIRICRPGSIIGPQQHFLEEKQASLWVQGDIFRSKLKNRPSSEGSINKILSGLD
DMSIGGNLSKTQNMERFGEDNLEDDDVEMKNGITQGDKLRALKSQRQPRTSPSCAFRSDD
TKGHPRAVSQPFRLSSSLQGSAVTLKTSKMALSPSATAKRINRTSLSSGATVRSFSINSR
LASSLGNLNAATDDPENKKTSSSSKAGFTASPFTNLLNGSSQPTTRNYPELNNNQYNRSS
NSNGGNLNSPPGPHSAKTEEHTTILRPSYTGLSSSSARFLSRSIPSLQSEYVHY
GenBank ID Protein 15451929
UniProtKB/Swiss-Prot ID Q9UNH5
UniProtKB/Swiss-Prot Entry Name CC14A_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_003672.3
GeneCard ID CDC14A
GenAtlas ID CDC14A
HGNC ID HGNC:1718
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  4. Li L, Ernsting BR, Wishart MJ, Lohse DL, Dixon JE: A family of putative tumor suppressors is structurally and functionally conserved in humans and yeast. J Biol Chem. 1997 Nov 21;272(47):29403-6. [PubMed:9367992 ]
  5. Wong AK, Chen Y, Lian L, Ha PC, Petersen K, Laity K, Carillo A, Emerson M, Heichman K, Gupte J, Tavtigian SV, Teng DH: Genomic structure, chromosomal location, and mutation analysis of the human CDC14A gene. Genomics. 1999 Jul 15;59(2):248-51. [PubMed:10409437 ]
  6. Bembenek J, Yu H: Regulation of the anaphase-promoting complex by the dual specificity phosphatase human Cdc14a. J Biol Chem. 2001 Dec 21;276(51):48237-42. Epub 2001 Oct 11. [PubMed:11598127 ]
  7. Kaiser BK, Zimmerman ZA, Charbonneau H, Jackson PK: Disruption of centrosome structure, chromosome segregation, and cytokinesis by misexpression of human Cdc14A phosphatase. Mol Biol Cell. 2002 Jul;13(7):2289-300. [PubMed:12134069 ]
  8. Mailand N, Lukas C, Kaiser BK, Jackson PK, Bartek J, Lukas J: Deregulated human Cdc14A phosphatase disrupts centrosome separation and chromosome segregation. Nat Cell Biol. 2002 Apr;4(4):317-22. [PubMed:11901424 ]
  9. Gruneberg U, Neef R, Honda R, Nigg EA, Barr FA: Relocation of Aurora B from centromeres to the central spindle at the metaphase to anaphase transition requires MKlp2. J Cell Biol. 2004 Jul 19;166(2):167-72. [PubMed:15263015 ]