Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08906
Secondary Accession Numbers
  • 14635
Name Dual specificity protein phosphatase 16
Synonyms
  1. MAP kinase phosphatase 7
  2. MKP-7
  3. Mitogen-activated protein kinase phosphatase 7
Gene Name DUSP16
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatase activity
Specific Function Dual specificity protein phosphatase involved in the inactivation of MAP kinases. Dephosphorylates MAPK10 bound to ARRB2.
Pathways
  • MAPK signaling pathway
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphate details
A phosphoprotein + Water → a protein + Phosphate details
GO Classification
Biological Process
MAPK export from nucleus
MAPK phosphatase export from nucleus, leptomycin B sensitive
peptidyl-tyrosine dephosphorylation
Cellular Component
cytoplasm
nucleus
cytoplasmic membrane-bounded vesicle
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
map kinase tyrosine/serine/threonine phosphatase activity
protein tyrosine/serine/threonine phosphatase activity
Molecular Function
MAP kinase tyrosine/serine/threonine phosphatase activity
protein tyrosine phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Nucleus
  2. Cytoplasm
  3. Cytoplasmic vesicle
Gene Properties
Chromosome Location 12
Locus 12p13
SNPs DUSP16
Gene Sequence
>1998 bp
ATGGCCCATGAGATGATTGGAACTCAAATTGTTACTGAGAGGTTGGTGGCTCTGCTGGAA
AGTGGAACGGAAAAAGTGCTGCTAATTGATAGCCGGCCATTTGTGGAATACAATACATCC
CACATTTTGGAAGCCATTAATATCAACTGCTCCAAGCTTATGAAGCGAAGGTTGCAACAG
GACAAAGTGTTAATTACAGAGCTCATCCAGCATTCAGCGAAACATAAGGTTGACATTGAT
TGCAGTCAGAAGGTTGTAGTTTACGATCAAAGCTCCCAAGATGTTGCCTCTCTCTCTTCA
GACTGTTTTCTCACTGTACTTCTGGGTAAACTGGAGAAGAGCTTCAACTCTGTTCACCTG
CTTGCAGGTGGGTTTGCTGAGTTCTCTCGTTGTTTCCCTGGCCTCTGTGAAGGAAAATCC
ACTCTAGTCCCTACCTGCATTTCTCAGCCTTGCTTACCTGTTGCCAACATTGGGCCAACC
CGAATTCTTCCCAATCTTTATCTTGGCTGCCAGCGAGATGTCCTCAACAAGGAGCTGATG
CAGCAGAATGGGATTGGTTATGTGTTAAATGCCAGCAATACCTGTCCAAAGCCTGACTTT
ATCCCCGAGTCTCATTTCCTGCGTGTGCCTGTGAATGACAGCTTTTGTGAGAAAATTTTG
CCGTGGTTGGACAAATCAGTAGATTTCATTGAGAAAGCAAAAGCCTCCAATGGATGTGTT
CTAGTGCACTGTTTAGCTGGGATCTCCCGCTCCGCCACCATCGCTATCGCCTACATCATG
AAGAGGATGGACATGTCTTTAGATGAAGCTTACAGATTTGTGAAAGAAAAAAGACCTACT
ATATCTCCAAACTTCAATTTTCTGGGCCAACTCCTGGACTATGAGAAGAAGATTAAGAAC
CAGACTGGAGCATCAGGGCCAAAGAGCAAACTCAAGCTGCTGCACCTGGAGAAGCCAAAT
GAACCTGTCCCTGCTGTCTCAGAGGGTGGACAGAAAAGCGAGACGCCCCTCAGTCCACCC
TGTGCCGACTCTGCTACCTCAGAGGCAGCAGGACAAAGGCCCGTGCATCCCGCCAGCGTG
CCCAGCGTGCCCAGCGTGCAGCCGTCGCTGTTAGAGGACAGCCCGCTGGTACAGGCGCTC
AGTGGGCTGCACCTGTCCGCAGACAGGCTGGAAGACAGCAATAAGCTCAAGCGTTCCTTC
TCTCTGGATATCAAATCAGTTTCATATTCAGCCAGCATGGCAGCATCCTTACATGGCTTC
TCCTCATCAGAAGATGCTTTGGAATACTACAAACCTTCCACTACTCTGGATGGGACCAAC
AAGCTATGCCAGTTCTCCCCTGTTCAGGAACTATCGGAGCAGACTCCCGAAACCAGTCCT
GATAAGGAGGAAGCCAGCATCCCCAAGAAGCTGCAGACCGCCAGGCCTTCAGACAGCCAG
AGCAAGCGATTGCATTCGGTCAGAACCAGCAGCAGTGGCACCGCCCAGAGGTCCCTTTTA
TCTCCACTGCATCGAAGTGGGAGCGTGGAGGACAATTACCACACCAGCTTCCTTTTCGGC
CTTTCCACCAGCCAGCAGCACCTCACGAAGTCTGCTGGCCTGGGCCTTAAGGGCTGGCAC
TCGGATATCTTGGCCCCCCAGACCTCTACCCCTTCCCTGACCAGCAGCTGGTATTTTGCC
ACAGAGTCCTCACACTTCTACTCTGCCTCAGCCATCTACGGAGGCAGTGCCAGTTACTCT
GCCTACAGCTGCAGCCAGCTGCCCACTTGCGGAGACCAAGTCTATTCTGTGCGCAGGCGG
CAGAAGCCAAGTGACAGAGCTGACTCGCGGCGGAGCTGGCATGAAGAGAGCCCCTTTGAA
AAGCAGTTTAAACGCAGAAGCTGCCAAATGGAATTTGGAGAGAGCATCATGTCAGAGAAC
AGGTCACGGGAAGAGCTGGGGAAAGTGGGCAGTCAGTCTAGCTTTTCGGGCAGCATGGAA
ATCATTGAGGTCTCCTGA
Protein Properties
Number of Residues 665
Molecular Weight 73100.95
Theoretical pI 7.463
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Dual specificity protein phosphatase 16
MAHEMIGTQIVTERLVALLESGTEKVLLIDSRPFVEYNTSHILEAININCSKLMKRRLQQ
DKVLITELIQHSAKHKVDIDCSQKVVVYDQSSQDVASLSSDCFLTVLLGKLEKSFNSVHL
LAGGFAEFSRCFPGLCEGKSTLVPTCISQPCLPVANIGPTRILPNLYLGCQRDVLNKELM
QQNGIGYVLNASNTCPKPDFIPESHFLRVPVNDSFCEKILPWLDKSVDFIEKAKASNGCV
LVHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTISPNFNFLGQLLDYEKKIKN
QTGASGPKSKLKLLHLEKPNEPVPAVSEGGQKSETPLSPPCADSATSEAAGQRPVHPASV
PSVPSVQPSLLEDSPLVQALSGLHLSADRLEDSNKLKRSFSLDIKSVSYSASMAASLHGF
SSSEDALEYYKPSTTLDGTNKLCQFSPVQELSEQTPETSPDKEEASIPKKLQTARPSDSQ
SKRLHSVRTSSSGTAQRSLLSPLHRSGSVEDNYHTSFLFGLSTSQQHLTKSAGLGLKGWH
SDILAPQTSTPSLTSSWYFATESSHFYSASAIYGGSASYSAYSCSQLPTCGDQVYSVRRR
QKPSDRADSRRSWHEESPFEKQFKRRSCQMEFGESIMSENRSREELGKVGSQSSFSGSME
IIEVS
GenBank ID Protein 38372911
UniProtKB/Swiss-Prot ID Q9BY84
UniProtKB/Swiss-Prot Entry Name DUS16_HUMAN
PDB IDs
GenBank Gene ID NM_030640.2
GeneCard ID DUSP16
GenAtlas ID DUSP16
HGNC ID HGNC:17909
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Nagase T, Kikuno R, Hattori A, Kondo Y, Okumura K, Ohara O: Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Dec 31;7(6):347-55. [PubMed:11214970 ]
  4. Hoornaert I, Marynen P, Goris J, Sciot R, Baens M: MAPK phosphatase DUSP16/MKP-7, a candidate tumor suppressor for chromosome region 12p12-13, reduces BCR-ABL-induced transformation. Oncogene. 2003 Oct 30;22(49):7728-36. [PubMed:14586399 ]
  5. Masuda K, Shima H, Watanabe M, Kikuchi K: MKP-7, a novel mitogen-activated protein kinase phosphatase, functions as a shuttle protein. J Biol Chem. 2001 Oct 19;276(42):39002-11. Epub 2001 Aug 6. [PubMed:11489891 ]
  6. Willoughby EA, Collins MK: Dynamic interaction between the dual specificity phosphatase MKP7 and the JNK3 scaffold protein beta-arrestin 2. J Biol Chem. 2005 Jul 8;280(27):25651-8. Epub 2005 May 10. [PubMed:15888437 ]